Recombinant Full Length Putative Calcium-Binding Mitochondrial Carrier F55A11.4(F55A11.4) Protein, His-Tagged
Cat.No. : | RFL29131CF |
Product Overview : | Recombinant Full Length Putative calcium-binding mitochondrial carrier F55A11.4(F55A11.4) Protein (Q20799) (1-588aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-588) |
Form : | Lyophilized powder |
AA Sequence : | MINKNEQTESTSGAAEQKEDDEEQYVQLSSLGEYKDEVTPLLSPKHVPLVLGKVTKEAAI ATHSALHGGMSEEKERQIRDIYDRLDIDNDGTIDIRDLTLALKHETPHIPANLAPVIMSK MSPDDEGRVDFYSFSSYVLENEQKLAEMFADMDRNHDGLVDVVEMKNYCKDIGVPLDDHK AQHIVNKMDQTGSASVDLKEFQEFMMLYPSSDLKDIVDFWRHNLIIDIGEDSQIPEDFSQ QEMQEGIWWRHLVAGGAAGAVSRTCTAPFDRIKVYLQVNSSKTNRLGVMSCLKLLHAEGG IKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQKKKGNEEISTFERLCAGSAAGAISQS TIYPMEVMKTRLALRKTGQLDRGIIHFAHKMYTKEGIRCFYKGYLPNLIGIIPYAGIDLA IYETLKRTYVRYYETNSSEPGVLALLACGTCSSTCGQLSSYPFALVRTRLQALSITRYSP QPDTMFGQFKYILQNEGVTGFYRGITPNFLKVIPAVSISYVVYEKVRTGLGVPVCSRGGL EDIHQFLPCSIHSIIQFFFFPRTFLLTISGRSLRVKPVWRSHFSKFNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F55A11.4 |
Synonyms | F55A11.4; Putative calcium-binding mitochondrial carrier F55A11.4 |
UniProt ID | Q20799 |
◆ Recombinant Proteins | ||
SEMA3FA-2292Z | Recombinant Zebrafish SEMA3FA | +Inquiry |
PLA2R1-4435H | Recombinant Human PLA2R1 protein, His-tagged | +Inquiry |
AL483-RS05640-1338S | Recombinant Staphylococcus simulans (strain: FDAARGOS_124, nat-host: Homo sapiens) AL483_RS05640 protein, His-tagged | +Inquiry |
YWHAQ-123H | Recombinant Human YWHAQ protein, MYC/DDK-tagged | +Inquiry |
HOXC9A-9076Z | Recombinant Zebrafish HOXC9A | +Inquiry |
◆ Native Proteins | ||
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPH4A-570HCL | Recombinant Human RSPH4A lysate | +Inquiry |
NT5C1A-444HCL | Recombinant Human NT5C1A lysate | +Inquiry |
Precentral Gyrus-399H | Human Precentral Gyrus (Alzheimers Disease) Lysate | +Inquiry |
CCDC24-7771HCL | Recombinant Human CCDC24 293 Cell Lysate | +Inquiry |
LCAT-4809HCL | Recombinant Human LCAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F55A11.4 Products
Required fields are marked with *
My Review for All F55A11.4 Products
Required fields are marked with *
0
Inquiry Basket