Recombinant Full Length Putative Antiporter Subunit Mnhg2(Mnhg2) Protein, His-Tagged
Cat.No. : | RFL34077SF |
Product Overview : | Recombinant Full Length Putative antiporter subunit mnhG2(mnhG2) Protein (Q0Q2J4) (1-145aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-145) |
Form : | Lyophilized powder |
AA Sequence : | MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAEKREEHRKKWYQND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhG2 |
Synonyms | mnhG2; mrpG2; Putative antiporter subunit mnhG2; Mrp complex subunit G2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2 |
UniProt ID | Q0Q2J4 |
◆ Recombinant Proteins | ||
FCGRT&B2M-1420R | Active Recombinant Rabbit FCGRT&B2M protein, His-tagged | +Inquiry |
PLEKHG7-3873H | Recombinant Human PLEKHG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHL12-615H | Recombinant Human KLHL12 Protein, GST/His-tagged | +Inquiry |
MYLZ3-9157Z | Recombinant Zebrafish MYLZ3 | +Inquiry |
RFL22742RF | Recombinant Full Length Rickettsia Conorii Succinate Dehydrogenase Hydrophobic Membrane Anchor Subunit(Sdhd) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
KRT19-40H | Native Human KRT19 protein | +Inquiry |
Small Intestine-014H | Human Small Intestine Lysate, Total Protein | +Inquiry |
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCKBR-168HCL | Recombinant Human CCKBR lysate | +Inquiry |
C1orf162-96HCL | Recombinant Human C1orf162 lysate | +Inquiry |
GFRA3-844MCL | Recombinant Mouse GFRA3 cell lysate | +Inquiry |
EVI5-6517HCL | Recombinant Human EVI5 293 Cell Lysate | +Inquiry |
SLC16A1-1802HCL | Recombinant Human SLC16A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnhG2 Products
Required fields are marked with *
My Review for All mnhG2 Products
Required fields are marked with *
0
Inquiry Basket