Recombinant Full Length Psychromonas Ingrahamii Na(+)-Translocating Nadh-Quinone Reductase Subunit E Protein, His-Tagged
Cat.No. : | RFL7037PF |
Product Overview : | Recombinant Full Length Psychromonas ingrahamii Na(+)-translocating NADH-quinone reductase subunit E Protein (A1SSY7) (1-202aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Psychromonas ingrahamii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-202) |
Form : | Lyophilized powder |
AA Sequence : | MEHYISIFVRSIFMENMALAFFLGMCTFLAVSKKVKTSMGLGVAVIVVLGISVPVNQIIY FNLLAPGALAWAGFPAADLSFLGFITFIGVIAALVQILEMVLDKYFPALYQALGIYLPLI TVNCAILGGVLFMVQREYNLMESLVYGVGSGVGWMLAIVLLAGIREKMKYSDVPAGLRGL GITFTTAGLMAIAFMSFSGIQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrE |
Synonyms | nqrE; Ping_0750; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E |
UniProt ID | A1SSY7 |
◆ Recombinant Proteins | ||
RFL27391CF | Recombinant Full Length Zygote Defective Protein 12(Zyg-12) Protein, His-Tagged | +Inquiry |
SLC35A5-10923Z | Recombinant Zebrafish SLC35A5 | +Inquiry |
PSMD10-4444R | Recombinant Rat PSMD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
XKR4-6269R | Recombinant Rat XKR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CA6-26443TH | Recombinant Human CA6 | +Inquiry |
◆ Native Proteins | ||
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
TcdB-189C | Active Native Clostridium difficile Toxin B Protein | +Inquiry |
ALB-316B | Native Bovine Albumin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf158-8175HCL | Recombinant Human C1orf158 293 Cell Lysate | +Inquiry |
BAIAP2-8522HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
BTN2A2-8388HCL | Recombinant Human BTN2A2 293 Cell Lysate | +Inquiry |
CHCHD7-7542HCL | Recombinant Human CHCHD7 293 Cell Lysate | +Inquiry |
TESK2-1761HCL | Recombinant Human TESK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nqrE Products
Required fields are marked with *
My Review for All nqrE Products
Required fields are marked with *
0
Inquiry Basket