Recombinant Full Length Psittacid Herpesvirus 1 Uncharacterized Protein Ul-1(Ul-1) Protein, His-Tagged
Cat.No. : | RFL34895PF |
Product Overview : | Recombinant Full Length Psittacid herpesvirus 1 Uncharacterized protein UL-1(UL-1) Protein (Q6UDG4) (1-433aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-433) |
Form : | Lyophilized powder |
AA Sequence : | MEVARDGIMHPVDDFLMVVKAAMLEMMMMGKMAERYYYYVQLAFKMLVGVLKNLPVVYSY RYDAREYITETSNAVLGDDEVFEFGSSGEMVNSFLAFLRRALDWCAKFDEPPDMGGHGIE FMYPTRPTRIQRSTMGYFVRPKVPAAIVADAAVAAANLHFSNQVGEVSVRVPSRDLQPGE AGPSSSGGGRRDPAQANRGPVARVTPFVVERRYEEGEPGENGDESDEDGGRMDGDEDAAQ SEQNNDDGMDYESDVTDHSSAWGEEPDRRHDAEAGERGSERSGSNSEADERRRSYENDDI QVDVTSVSEDSESDGDFEERRDARIRGATADAPRPRRGEREEDDERGEGAANDGGRRPAR RDSPDSVIVIDDTSSSEDETFPPVLWLQRRDDPRTLLSRTRRAASRTRTIGGTRPRSRSP HRRGEGRDLPEDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UL-1 |
Synonyms | UL-1; Uncharacterized protein UL-1 |
UniProt ID | Q6UDG4 |
◆ Native Proteins | ||
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
ALB-124P | Native Porcine serum albumin | +Inquiry |
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASD1-528HCL | Recombinant Human RASD1 lysate | +Inquiry |
MMP9-2026MCL | Recombinant Mouse MMP9 cell lysate | +Inquiry |
HA-001H1N1CL | Recombinant H1N1 HA cell lysate | +Inquiry |
PRELP-001HCL | Recombinant Human PRELP cell lysate | +Inquiry |
BRD4-179HCL | Recombinant Human BRD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UL-1 Products
Required fields are marked with *
My Review for All UL-1 Products
Required fields are marked with *
0
Inquiry Basket