Recombinant Full Length Psilotum Nudum Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged
Cat.No. : | RFL6553PF |
Product Overview : | Recombinant Full Length Psilotum nudum Photosystem II D2 protein(psbD) Protein (Q8WI19) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Psilotum nudum (Whisk fern) (Lycopodium nudum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MTIAIGKSSKEPKDLFDTMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFIAFHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbD |
Synonyms | psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein |
UniProt ID | Q8WI19 |
◆ Recombinant Proteins | ||
SUJ-0009P2-2434S | Recombinant Staphylococcus aureus (strain: 18810) SUJ_0009P2 protein, His-tagged | +Inquiry |
NEK9-1064H | Active Recombinant Human NEK9, GST-tagged | +Inquiry |
RTD1C-4048R | Recombinant Rhesus monkey RTD1C Protein, His-tagged | +Inquiry |
RCN3-14037M | Recombinant Mouse RCN3 Protein | +Inquiry |
PIK3CA-PIK3R1-140HFL | Active Recombinant Full Length Human PIK3CA(H1047R) and PIK3R1 Mutation Co-expressed Protein, N-His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-346D | Native Dog Gamma Globulin Fraction | +Inquiry |
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
Lectin-1718P | Native Peanut Lectin, PE conjugated | +Inquiry |
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRD2-177HCL | Recombinant Human BRD2 cell lysate | +Inquiry |
CD3D-1466CCL | Recombinant Cynomolgus CD3D cell lysate | +Inquiry |
Adipose-345M | Mouse Mouse Adipose Lysate | +Inquiry |
ATP1A4-46HCL | Recombinant Human ATP1A4 lysate | +Inquiry |
PYCR1-1448HCL | Recombinant Human PYCR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbD Products
Required fields are marked with *
My Review for All psbD Products
Required fields are marked with *
0
Inquiry Basket