Recombinant Full Length Pseudomonas Syringae Pv. Tomato Upf0114 Protein Pspto_4583(Pspto_4583) Protein, His-Tagged
Cat.No. : | RFL18041PF |
Product Overview : | Recombinant Full Length Pseudomonas syringae pv. tomato UPF0114 protein PSPTO_4583(PSPTO_4583) Protein (Q87WG7) (1-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Syringae Pv. Tomato |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-162) |
Form : | Lyophilized powder |
AA Sequence : | MERFFENAMYASRWLLAPIYFGLSLGLLALCLKFFQEIFHVIPNIFSLAEADLILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDEDKEKLNWLGTMDSSSLKMKVAASIVAISSIH LLRVFMDATNIKPEYLMWYVIIHMTFVISAFAMGYLDKLTKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PSPTO_4583 |
Synonyms | PSPTO_4583; UPF0114 protein PSPTO_4583 |
UniProt ID | Q87WG7 |
◆ Native Proteins | ||
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
H3N20194-213I | Native H3N2 (A/Kiev/301/94) H3N20194 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPM3-6833HCL | Recombinant Human DPM3 293 Cell Lysate | +Inquiry |
PTK6-709HCL | Recombinant Human PTK6 cell lysate | +Inquiry |
FAM228A-8060HCL | Recombinant Human C2orf84 293 Cell Lysate | +Inquiry |
CD200-2638MCL | Recombinant Mouse CD200 cell lysate | +Inquiry |
RAB33B-1452HCL | Recombinant Human RAB33B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PSPTO_4583 Products
Required fields are marked with *
My Review for All PSPTO_4583 Products
Required fields are marked with *
0
Inquiry Basket