Recombinant Full Length Pseudomonas Syringae Pv. Syringae Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL18141PF |
Product Overview : | Recombinant Full Length Pseudomonas syringae pv. syringae Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (Q4ZT65) (1-653aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas syringae pv. syringae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-653) |
Form : | Lyophilized powder |
AA Sequence : | MSRALLELNGVTRRFVAGEKDFIALNDINLTINAGELVAITGASGSGKSTLMNVLGCLDH PNSGSYKVDGRETGTLTDDELAELRRDHFGFIFQRYHLLPHLAAIQNVEMPAIYAGTGKG MRVERAQKLLERLGLSGHLEHRPSQLSGGQQQRVSIARALMNGGEIILADEPTGALDSVS GKEVMNILLELNSAGHTVILVTHDEKVAAHAERIIEMRDGEIIADRVNTDRPIINEKTTE RLPTKPRQGNRLMANIGLFQEAFVMAWVALISHRMRTLLTMLGIIIGITSVVSIVAIGEG AKRYVLKDIQAIGSNTIEVFPGSDFGDTKSMDIQTLALSDVAALSSEYYIDSATPNIGRN LLVRYRNIDVSATVSGVSPSYFQVRGTKMGLGVGFNKDDARRQAQVVVIDHNTRIRLFGP KVDPLGQVILVGNLPCTVIGVTENKKNIFDTSKNLNIWMPYETASGRLLGQTYLDGITVR VKDGQPSKVVEDNVNKLLQKRHGTKDFFTYNLDSVMQTVQKTSQSLALLLSLIAVISLAV GGIGVMNIMLVSVTERTREIGIRMAVGARQSDIRQQFLVEAVMVCLIGGVIGISLSFVIG YVFSLLVKEWQMVFSLGSIVTAFICSTLIGIVFGFVPARNAAQLDPIEALARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; Psyr_2618; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | Q4ZT65 |
◆ Recombinant Proteins | ||
FNDC5-134H | Recombinant Human FNDC5 Protein | +Inquiry |
pyp-3921C | Recombinant Chromatium salexigens pyp protein(1-125aa), His-tagged | +Inquiry |
FUS-5333H | Recombinant Human FUS protein, His-MBP-tagged | +Inquiry |
PHF7-3227R | Recombinant Rhesus Macaque PHF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFHD2-4232Z | Recombinant Zebrafish EFHD2 | +Inquiry |
◆ Native Proteins | ||
CTSL1-27406TH | Native Human CTSL1 | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
ALP-8330C | Native Calf ALP | +Inquiry |
HP-133B | Native Bovine Haptoglobin | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS11-1911HCL | Recombinant Human VPS11 cell lysate | +Inquiry |
TGFBI-2766HCL | Recombinant Human TGFBI cell lysate | +Inquiry |
Arabidopsis-9119A | Arabidopsis Thaliana Whole Plant Tissue Lysate | +Inquiry |
XRCC3-256HCL | Recombinant Human XRCC3 293 Cell Lysate | +Inquiry |
ZNF446-2029HCL | Recombinant Human ZNF446 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket