Recombinant Full Length Pseudomonas Phage Pf1 Uncharacterized Protein Orf430 Protein, His-Tagged
Cat.No. : | RFL9415PF |
Product Overview : | Recombinant Full Length Pseudomonas phage Pf1 Uncharacterized protein ORF430 Protein (P25130) (1-430aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas phage Pf1 (Bacteriophage Pf1) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-430) |
Form : | Lyophilized powder |
AA Sequence : | MKTPIHPTRLVLEENGDFHKSPKGMLFMDPLNGQFTDLSGVRILRCGVDTVRQLYNGKLR PEVMALFDLSVDVVEFAGYEWSKGRIGRDSGYQYRLQNAEMGLILLIKNHNIKVDTIGSH LKIEVSPHAIDGADPRILQGVLDDLAAAVLSHCETNQAAVHIALDVQGWTPPADLVDRMH CRSRRVRQISGIERIEFDGNASVYGRGETYMFGSANGLQLSIYNKTLQARATDKLDYWES VWATLNGDPFGDGDPAYNPLETVWRIEFRYHHSIVQQFSEGSRMASGEVIGCRTYEGLCP HLQGLWNYACEAFRVLSREGMYDAFWSLISLDARVQVECDPLIERTEYRRYYKTAKGFSG RNCEMFLGQFVSLIARERVPAKKAIESARKLEFWHVIEDHYLAKGWTRRDLERHIHKLMC DRYLRKGYAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pseudomonas phage Pf1 Uncharacterized protein ORF430 |
Synonyms | Uncharacterized protein ORF430; ORF430 |
UniProt ID | P25130 |
◆ Recombinant Proteins | ||
RFL33094SF | Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
TXNRD2-6379R | Recombinant Rat TXNRD2 Protein | +Inquiry |
MAN2B1-9486M | Recombinant Mouse MAN2B1 Protein | +Inquiry |
HCV2_gp1-146H | Recombinant Hepatitis C Virus HCV2_gp1 protein | +Inquiry |
SPANXN4-427H | Recombinant Human SPANXN4 | +Inquiry |
◆ Native Proteins | ||
MB-02B | Native Bovine MB Protein | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
MMP7-28205TH | Native Human MMP7 | +Inquiry |
Lectin-1776G | Active Native Galanthus Nivalis Lectin Protein, Agarose bound | +Inquiry |
IgGF-330C | Native Chicken IgG Fab | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCBP1-1171HCL | Recombinant Human NCBP1 cell lysate | +Inquiry |
GPR18-5792HCL | Recombinant Human GPR18 293 Cell Lysate | +Inquiry |
SMAD9-1645HCL | Recombinant Human SMAD9 cell lysate | +Inquiry |
TST-1849HCL | Recombinant Human TST cell lysate | +Inquiry |
ITGB1BP2-878HCL | Recombinant Human ITGB1BP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pseudomonas phage Pf1 Uncharacterized protein ORF430 Products
Required fields are marked with *
My Review for All Pseudomonas phage Pf1 Uncharacterized protein ORF430 Products
Required fields are marked with *
0
Inquiry Basket