Recombinant Full Length Pseudomonas Oleovorans Alkane 1-Monooxygenase(Alkb) Protein, His-Tagged
Cat.No. : | RFL24385PF |
Product Overview : | Recombinant Full Length Pseudomonas oleovorans Alkane 1-monooxygenase(alkB) Protein (P12691) (1-401aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas oleovorans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-401) |
Form : | Lyophilized powder |
AA Sequence : | MLEKHRVLDSAPEYVDKKKYLWILSTLWPATPMIGIWLANETGWGIFYGLVLLVWYGALP LLDAMFGEDFNNPPEEVVPKLEKERYYRVLTYLTVPMHYAALIVSAWWVGTQPMSWLEIG ALALSLGIVNGLALNTGHELGHKKETFDRWMAKIVLAVVGYGHFFIEHNKGHHRDVATPM DPATSRMGESIYKFSIREIPGAFIRAWGLEEQRLSRRGQSVWSFDNEILQPMIITVILYA VLLALFGPKMLVFLPIQMAFGWWQLTSANYIEHYGLLRQKMEDGRYEHQKPHHSWNSNHI VSNLVLFHLQRHSDHHAHPTRSYQSLRDFPGLPALPTGYPGAFLMAMIPQWFRSVMDPKV VDWAGGDLNKIQIDDSMRETYLKKFGTSSAGHSSSTSAVAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alkB |
Synonyms | alkB; Alkane 1-monooxygenase; Alkane hydroxylase; AHs; Terminal alkane hydroxylase |
UniProt ID | P12691 |
◆ Recombinant Proteins | ||
SAOUHSC-02932-3541S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_02932 protein, His-tagged | +Inquiry |
IFNA1-633D | Recombinant Dog IFNA1 protein, His & GST-tagged | +Inquiry |
INSIG1-3078R | Recombinant Rat INSIG1 Protein | +Inquiry |
SLC2A1-059H | Recombinant Human SLC2A1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD3E-275H | Recombinant Human CD3E, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
IgG-352G | Native HAMSTER IgG | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
RV-17 | Native Rotavirus Antigen | +Inquiry |
Protein Z-91H | Native Human Protein Z | +Inquiry |
TSH-1315B | Active Native Bovine TSH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LINC00909-4685HCL | Recombinant Human LOC400657 293 Cell Lysate | +Inquiry |
NRDE2-8293HCL | Recombinant Human C14orf102 293 Cell Lysate | +Inquiry |
MAP2K6-001HCL | Recombinant Human MAP2K6 cell lysate | +Inquiry |
C6orf120-7999HCL | Recombinant Human C6orf120 293 Cell Lysate | +Inquiry |
SLC25A24-1624HCL | Recombinant Human SLC25A24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All alkB Products
Required fields are marked with *
My Review for All alkB Products
Required fields are marked with *
0
Inquiry Basket