Recombinant Full Length Pseudomonas Entomophila Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL2411PF |
Product Overview : | Recombinant Full Length Pseudomonas entomophila Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (Q1I7I9) (1-654aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas entomophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-654) |
Form : | Lyophilized powder |
AA Sequence : | MSAPLIELCDIRKAYGGIDSPKVEVLRGISLSIHPGEFVAIVGASGSGKSTLMNILGCLD RPTSGSYRFAGRDVAELDSDELAWLRREAFGFVFQGYHLIPSGSAQENVEMPAIYAGTPP AERHARALALLDRLGLASRTGNRPHQLSGGQQQRVSIARALMNGGHIILADEPTGALDSH SGAEVMALLDELASQGHVIILITHDREVAARAQRIIEIRDGQMVSDSAASQPSPAQPEQL QANDLRQRLDRGAILKGAWKGEMIEALQAAWRVMWINRFRTALTLLGIIIGVASVVVMLA VGEGSKRQVMAQMAAFGSNILYLNGKRATAQEPGGIVTLDDVAAIGELPQVLHVMPVIGG QLMVRQGNSSQKFYVGGNNTWFPAIFNWPVVEGTFFSEADEASGAAVAVIGQKVRSKMFG EGSNPLGQYLLIGNVPFQVVGILAAKGASSGSEDSDERIVVPYSAASIRLFGSHDPEYVA IAAIDSRRVNETEAAIDRLLRQRHQGKHDFDLTNDAALIQAEARTQNSLSLMLGAIAAIS LLVGGIGVMNIMLMTVRERTREIGIRMATGARQRDILRQFLTEAVMLSMVGGVTGIVIAL LVGGGLLLADIAVAFALPAILGAFACAVITGVVFGFMPARKAARLDPVKALTSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; PSEEN3665; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | Q1I7I9 |
◆ Recombinant Proteins | ||
COL10A1-3713M | Recombinant Mouse COL10A1 Protein | +Inquiry |
tcdB-1493C | Recombinant Clostridioides difficile tcdB Protein (Gly1834-Glu2053), N-His and SUMO tagged | +Inquiry |
CLEC14A-546R | Recombinant Rat Clec14a, Fc tagged | +Inquiry |
MEN1-6132HF | Recombinant Full Length Human MEN1 Protein, GST-tagged | +Inquiry |
WNT9B-7220Z | Recombinant Zebrafish WNT9B | +Inquiry |
◆ Native Proteins | ||
Ferritin-026H | Native Human Ferritin Protein, holo form | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
TF-262H | Native Human Transferrin | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
IgG-020S | Native Sheep Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Muscles-803G | Guinea Pig S. Muscles Membrane Lysate, Total Protein | +Inquiry |
NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Intestine-613R | Rat Intestine whole Lysate, Total Protein | +Inquiry |
MRS2-67HCL | Recombinant Full Length Human MRS2 overexpression lysate | +Inquiry |
CERK-7567HCL | Recombinant Human CERK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket