Recombinant Full Length Pseudomonas Aeruginosa Nitric Oxide Reductase Subunit C(Norc) Protein, His-Tagged
Cat.No. : | RFL5410PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Nitric oxide reductase subunit C(norC) Protein (Q59646) (2-146aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-146) |
Form : | Lyophilized powder |
AA Sequence : | SETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAMSAAVVRGKLVWEQNNC VGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMNIQPLNVPGRRAMPQFHLSEGQ VDDLAEFLKWSSKIDTNQWPPNKEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | norC |
Synonyms | norC; PA0523; Nitric oxide reductase subunit C; NOR small subunit; Nitric oxide reductase cytochrome c subunit |
UniProt ID | Q59646 |
◆ Recombinant Proteins | ||
KIFC1-382H | Recombinant Human KIFC1, His-tagged | +Inquiry |
LAMTOR4-161H | Recombinant Human LAMTOR4 Protein, MYC/DDK-tagged | +Inquiry |
TAL2-11484Z | Recombinant Zebrafish TAL2 | +Inquiry |
OR6M1-3049R | Recombinant Rhesus Macaque OR6M1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21228SF | Recombinant Full Length Staphylococcus Aureus Protein Crcb Homolog 2(Crcb2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
CTSH-190H | Active Native Human Cathepsin H | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF573-2058HCL | Recombinant Human ZNF573 cell lysate | +Inquiry |
MAPK9-4486HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
RAW 264.7-153M | RAW 264.7 Whole Cell Lysate | +Inquiry |
CPBTT-30929CH | Chicken Anti-Human PI3K Polyclonal Antibody | +Inquiry |
AKR1D1-8928HCL | Recombinant Human AKR1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All norC Products
Required fields are marked with *
My Review for All norC Products
Required fields are marked with *
0
Inquiry Basket