Recombinant Full Length Pseudomonas Aeruginosa Nadh-Quinone Oxidoreductase Subunit A 2(Nuoa2) Protein, His-Tagged
Cat.No. : | RFL1658PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2(nuoA2) Protein (Q9I0K1) (1-137aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-137) |
Form : | Lyophilized powder |
AA Sequence : | MPNPAELAAHHWGFAAFLLGVVGLLAFMLGVSSLLGSKAFGRSKNEPFESGIVPTGGARL RLSAKFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGA LDWAPESRRKRQAKLKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nuoA2 |
Synonyms | nuoA2; PA2637; NADH-quinone oxidoreductase subunit A 2; NADH dehydrogenase I subunit A 2; NDH-1 subunit A 2; NUO1 2 |
UniProt ID | Q9I0K1 |
◆ Native Proteins | ||
LEL/LEA-070TB | Native Tomato Lycopersicon esculentum Lectin (LEL/LEA) | +Inquiry |
Neuraminidase-007C | Active Native Clostridium perfringens Neuraminidase, Type X | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTAFR-2731HCL | Recombinant Human PTAFR 293 Cell Lysate | +Inquiry |
Placenta-387H | Human Placenta Membrane Lysate | +Inquiry |
SPERT-628HCL | Recombinant Human SPERT lysate | +Inquiry |
PRAP1-001HCL | Recombinant Human PRAP1 cell lysate | +Inquiry |
TCTE1-1163HCL | Recombinant Human TCTE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nuoA2 Products
Required fields are marked with *
My Review for All nuoA2 Products
Required fields are marked with *
0
Inquiry Basket