Recombinant Full Length Pseudoalteromonas Haloplanktis Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL32800PF |
Product Overview : | Recombinant Full Length Pseudoalteromonas haloplanktis Membrane protein insertase YidC(yidC) Protein (Q3IK55) (1-544aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudoalteromonas haloplanktis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-544) |
Form : | Lyophilized powder |
AA Sequence : | MESQRTFLFIGLMLVSFLLFQEWNTDYNTPKADPSATTQTLNPTSSESEDYVPTSSDSAL PASATLAKRSVIEITTDVFKVKIDTRGGDIVETYLLQYEETKGSETPYMLLGEFDGKQYF SQSGLIGLNGPDASAQGRPTYHVEQKSYTLTGDELRVPLQFTDSNGVNFTKTYVFKKGQY DVALEYTINNTTSTPLQVQLYTQVKRTVQDKGSMVDQNYLGAAYGTDDDPYEKYSFSDMA DKNLNKITLGGYVAFIQHYFVSAWVPMQDQSNTLYSLITKSNAAIIGVKDEAVNIQAGSE QTLTATYYMGPKESDVLEAIHPDLDLTVDYGWLWFISQPLFVLLKWLHSILGNWGVAIIA ITIIVKSLMYPLTKAQYTSMAKMRALQPKMAALKEKFGDDRQKFGQATMEMYKKEKVNPM GGCFPILLQMPIFLALFYVFLESTELRHAEFIFWLTDLSAKDPYYVLPILFGASMFITQK LQPMTVTDPMQQKMMTFMPVIFSVFFLWFPSGLVLYWLVSNLISIVQMLIIYRGMEKKGI KVRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; PSHAa3022; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q3IK55 |
◆ Recombinant Proteins | ||
TPSB2-418H | Recombinant Human TPSB2 Protein, His-tagged | +Inquiry |
NIPA2-2507C | Recombinant Chicken NIPA2 | +Inquiry |
LRRC16A-5171M | Recombinant Mouse LRRC16A Protein, His (Fc)-Avi-tagged | +Inquiry |
PADR-0635B | Recombinant Bacillus subtilis PADR protein, His-tagged | +Inquiry |
CPLX4A-4669Z | Recombinant Zebrafish CPLX4A | +Inquiry |
◆ Native Proteins | ||
IgG-01C | Native Human COVID-19 Convalescent Plasma IgG | +Inquiry |
IgG-343M | Native MONKEY IgG | +Inquiry |
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
Lectin-1731R | Active Native Ricinus Communis Agglutinin I Protein, Rhodamine labeled | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPDA2-5842HCL | Recombinant Human GNPDA2 293 Cell Lysate | +Inquiry |
CDC40-7658HCL | Recombinant Human CDC40 293 Cell Lysate | +Inquiry |
TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
NEK6-3877HCL | Recombinant Human NEK6 293 Cell Lysate | +Inquiry |
CKMT1A-001HCL | Recombinant Human CKMT1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket