Recombinant Full Length Protochlamydia Amoebophila Upf0365 Protein Pc1737(Pc1737) Protein, His-Tagged
Cat.No. : | RFL35739PF |
Product Overview : | Recombinant Full Length Protochlamydia amoebophila UPF0365 protein pc1737(pc1737) Protein (Q6MAD8) (1-342aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Protochlamydia amoebophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-342) |
Form : | Lyophilized powder |
AA Sequence : | MSTLLLQNLLENGTEFYFFIFVLAIVLLIILSVIGKFISLWFQAFVSGTPIPLFNIIGMS LRKIPPREIVNARINLYKAGLKDIHVGDLETHYLAGGHVPNVVEALIAADKANIPLDWRR ATAIDLAGRDIKAAVQTSVNPRVIDCPNHGGYITGVAKDGIQLNCRARVTVRTNIAQLVG GATEETIIARVGEGIVSAIGGSDTHKQVLESPQKISKLVLEKGLDSSTAFLILSIDIVEI NLGENIGAKLRTDQAESDIRIAKAEAEKRRTMAVAQEQENLAKVRDMEAKLVEAQAAVPL AMAEAFRSGKLGIMDYQRIQNIQSDTDMRNALAKPDSDKKQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pc1737 |
Synonyms | floA; pc1737; Flotillin-like protein FloA |
UniProt ID | Q6MAD8 |
◆ Recombinant Proteins | ||
PES1-1352H | Recombinant Human PES1 protein, His&Myc-tagged | +Inquiry |
IRAK3-1792HFL | Recombinant Full Length Human IRAK3 Protein, C-Flag-tagged | +Inquiry |
UAP1-2162H | Recombinant Human UAP1 Protein (1-522 aa), His-tagged | +Inquiry |
IL2RG-6096C | Recombinant Chicken IL2RG | +Inquiry |
Cdc45-857M | Recombinant Mouse Cdc45 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
Glycogen-006B | Native Bovine or Rabbit Glycogen | +Inquiry |
HSV-1ag-265V | Active Native HSV-1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLBD2-922HCL | Recombinant Human PLBD2 cell lysate | +Inquiry |
SEC23A-1994HCL | Recombinant Human SEC23A 293 Cell Lysate | +Inquiry |
CDH1-736RCL | Recombinant Rat CDH1 cell lysate | +Inquiry |
PRCC-2890HCL | Recombinant Human PRCC 293 Cell Lysate | +Inquiry |
GPBAR1-5814HCL | Recombinant Human GPBAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pc1737 Products
Required fields are marked with *
My Review for All pc1737 Products
Required fields are marked with *
0
Inquiry Basket