Recombinant Full Length Proteus Mirabilis Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged
Cat.No. : | RFL15661PF |
Product Overview : | Recombinant Full Length Proteus mirabilis Glycerol-3-phosphate acyltransferase(plsY) Protein (B4EW52) (1-218aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Proteus mirabilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-218) |
Form : | Lyophilized powder |
AA Sequence : | MSANALGMIIFAYLCGSISSAILICRLARLPDPRKFGSGNPGATNVLRIGGKLAAASVLI CDVLKGMIPVWLAYYLNVPPFYLGIVAIAACLGHIYPVFFHFKGGKGVATAFGSIAAIGW DLSGLIAGTWLLTVLLSGYSSLGAIISALLAPFYVWWFKPEFTYPVALLSCLVLYRHHDN IQRLWRGQESRIWHKLKKKTEKTDKEIIQEAKEQEKED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plsY |
Synonyms | plsY; PMI2364; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase |
UniProt ID | B4EW52 |
◆ Recombinant Proteins | ||
AUH-308R | Recombinant Rhesus Macaque AUH Protein, His (Fc)-Avi-tagged | +Inquiry |
TTYH2-17605M | Recombinant Mouse TTYH2 Protein | +Inquiry |
UBASH3B-509H | Recombinant Human UBASH3B protein(Gln382-Glu649), His-tagged | +Inquiry |
AVP-912M | Recombinant Mouse AVP Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP1-98HF | Recombinant Full Length Human CSRP1 Protein | +Inquiry |
◆ Native Proteins | ||
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
PLAT-29690TH | Native Human Human SERPINE1 | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
RV-17 | Native Rotavirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDAR-1021CCL | Recombinant Cynomolgus EDAR cell lysate | +Inquiry |
MCTS1-4410HCL | Recombinant Human MCTS1 293 Cell Lysate | +Inquiry |
PHLDA1-3221HCL | Recombinant Human PHLDA1 293 Cell Lysate | +Inquiry |
PPP1CB-2949HCL | Recombinant Human PPP1CB 293 Cell Lysate | +Inquiry |
FAM127C-6433HCL | Recombinant Human FAM127C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All plsY Products
Required fields are marked with *
My Review for All plsY Products
Required fields are marked with *
0
Inquiry Basket