Recombinant Full Length Protein Tweety Homolog 1(Ttyh-1) Protein, His-Tagged
Cat.No. : | RFL32081CF |
Product Overview : | Recombinant Full Length Protein tweety homolog 1(ttyh-1) Protein (Q20332) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MTFASFLINFYSVIPRLNFKFHWTNDVFNLEWSSEYFQALALVACLGAAVSLLLLVTIII VWICQACHKNETTGKTRRRVRRLSTVLFIISVLCFFMLGVCLFANEHVNRGMSISINSII NTKKSYQISTAQISQFQEAALNTTVHLKNLEDTVHVESKKTKNATIVQQIDQILTNITDE IDIIAKNGKLFQAKHGDDIGKLEKIRKVLSLYESERWAFLVILLSITMVVLFTGVVAFCK QSKKGAVVFSAIGFFIFVVVWLLISISLPLTIALADFCRDGDQVTRKNLGNLYETVQFYN TCVPVTTHDNLPLPVARHVALLNNIPANKSQLDRLMEVAFNSSAAIVNSSSAVGDDITKM LKLAGAVSSSSSCYVFHDDVVNFYYGTCNQSVAGMSIYMLSILLLGVFLFILLIVVSKTW NLFSRLPNEYTEVDEDDPFFPRGVNDSTIPVDIYGTHVYNPRTRDRTEPSTNTTSGTADE PNAPLWSQNVTVPLVSNSMSRQPFMSDHPYNNYEDRYNM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ttyh-1 |
Synonyms | ttyh-1; F42E11.2; Protein tweety homolog 1 |
UniProt ID | Q20332 |
◆ Recombinant Proteins | ||
Snx27-6029M | Recombinant Mouse Snx27 Protein, Myc/DDK-tagged | +Inquiry |
RAB17-7341M | Recombinant Mouse RAB17 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAC9-3459R | Recombinant Rhesus monkey PLAC9 Protein, His-tagged | +Inquiry |
GPM6B-2642R | Recombinant Rat GPM6B Protein | +Inquiry |
IL1R2-816H | Recombinant Human IL1R2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
SERPINA3-27285TH | Native Human SERPINA3 | +Inquiry |
Serpinc1-5485M | Native Mouse Serpin (or cysteine) Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
GOT-185H | Active Native Human Glutamate Oxaloacetate Tranasminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG4-1328RCL | Recombinant Rat REG4 cell lysate | +Inquiry |
HERPUD1-5585HCL | Recombinant Human HERPUD1 293 Cell Lysate | +Inquiry |
CFHR2-1391HCL | Recombinant Human CFHR2 cell lysate | +Inquiry |
REC8-2431HCL | Recombinant Human REC8 293 Cell Lysate | +Inquiry |
SLC25A3-1772HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ttyh-1 Products
Required fields are marked with *
My Review for All ttyh-1 Products
Required fields are marked with *
0
Inquiry Basket