Recombinant Full Length Protein Translocase Subunit Secf(Secf) Protein, His-Tagged
Cat.No. : | RFL13525VF |
Product Overview : | Recombinant Full Length Protein translocase subunit SecF(secF) Protein (E9RGS4) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio alginolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MFQILKAEKTIGFMRWSKVAFVFSIFMIAASIFTLSTKWLNWGLDFTGGTLIEVGFEKPA NLEKIRTALDAKGFGDATVQNFGSAREVMVRLRPRDDVSGETLGNQIIGAIKDGTGESVE MRRIEFVGPNVGDELTEAGGLAILVSLICILLYVSMRFEWRLAAGAVMALAHDIIITLGV FSFLQIEVDLTIVAALLTVVGYSLNDTIVVFDRIRENFRKMRKGEPADIMDASITQTLSR TLITSGTTLFVVIALFMQGGAMIHGFATALLLGITVGTYSSIYVASALALKLGIQKEHLM PPQVEKEGAEFDEMP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secF |
Synonyms | secF; Protein translocase subunit SecF |
UniProt ID | E9RGS4 |
◆ Recombinant Proteins | ||
RFL19745BF | Recombinant Full Length Bacillus Pumilus Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
NAMPT-905H | Recombinant Human NAMPT | +Inquiry |
TARDBP-3014H | Recombinant Human TARDBP protein, His-tagged | +Inquiry |
PPP1R1A-3565R | Recombinant Rhesus monkey PPP1R1A Protein, His-tagged | +Inquiry |
SLC35A3B-2617Z | Recombinant Zebrafish SLC35A3B | +Inquiry |
◆ Native Proteins | ||
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
Kidney-003H | Human Kidney Lysate, Total Protein | +Inquiry |
CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MUTED-4053HCL | Recombinant Human MUTED 293 Cell Lysate | +Inquiry |
SPARC-2616HCL | Recombinant Human SPARC cell lysate | +Inquiry |
GSC-5728HCL | Recombinant Human GSC 293 Cell Lysate | +Inquiry |
IL12B-1000MCL | Recombinant Marmoset IL12B cell lysate | +Inquiry |
DYSFIP1-6748HCL | Recombinant Human DYSFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secF Products
Required fields are marked with *
My Review for All secF Products
Required fields are marked with *
0
Inquiry Basket