Recombinant Full Length Protein Mxig(Mxig) Protein, His-Tagged
Cat.No. : | RFL35184SF |
Product Overview : | Recombinant Full Length Protein mxiG(mxiG) Protein (P0A221) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTD SKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDKSRGHILNG MYKNHSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDKRYGIVNTGQCNYILAETQND AVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFPFINLYVLNLVSDKAELLVFLSK ERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHNARGDAKGIFTKVNVQYKEICENNK VTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLIDDDFKGKSYLNSKDSYVMLN DKHWFFLDKNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mxiG |
Synonyms | mxiG; CP0136; Protein MxiG |
UniProt ID | P0A221 |
◆ Recombinant Proteins | ||
EBP-797H | Recombinant Human EBP Protein, His (Fc)-Avi-tagged | +Inquiry |
NAGK-4896H | Recombinant Human NAGK protein, His-SUMO-tagged | +Inquiry |
GINS4-4910H | Recombinant Human GINS4 Protein, GST-tagged | +Inquiry |
GSTZ1-13585H | Recombinant Human GSTZ1, GST-tagged | +Inquiry |
TTC9B-4010Z | Recombinant Zebrafish TTC9B | +Inquiry |
◆ Native Proteins | ||
FGF2-26551TH | Native Human FGF2 | +Inquiry |
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
Avidin-155C | Active Native Chicken Egg White Avidin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF2-518HCL | Recombinant Human ATF2 cell lysate | +Inquiry |
FUT6-6113HCL | Recombinant Human FUT6 293 Cell Lysate | +Inquiry |
C12orf10-8330HCL | Recombinant Human C12orf10 293 Cell Lysate | +Inquiry |
CCT7-313HCL | Recombinant Human CCT7 cell lysate | +Inquiry |
GOLT1A-300HCL | Recombinant Human GOLT1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mxiG Products
Required fields are marked with *
My Review for All mxiG Products
Required fields are marked with *
0
Inquiry Basket