Recombinant Full Length Protein Hflk(Hflk) Protein, His-Tagged
Cat.No. : | RFL31127EF |
Product Overview : | Recombinant Full Length Protein HflK(hflK) Protein (P0ABC8) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSHLVEP GLNWKPTFIDEVKPVNVEAVRELAASGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSP DDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQA ARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKAQTILE AQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQMLK GGNAPAAKSDNGASNLLRLPPASSSTTSGASNTSSTSQGDIMDQRRANAQRNDYQRQGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hflK |
Synonyms | hflK; Z5781; ECs5150; Protein HflK |
UniProt ID | P0ABC8 |
◆ Recombinant Proteins | ||
A2ML-7229Z | Recombinant Zebrafish A2ML | +Inquiry |
CCNE2-3047H | Recombinant Human CCNE2 protein, His-tagged | +Inquiry |
RFL5654OF | Recombinant Full Length Oenococcus Oeni Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
PNMA2-3489R | Recombinant Rhesus monkey PNMA2 Protein, His-tagged | +Inquiry |
KIFC1-2916R | Recombinant Rat KIFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
PGC-132H | Native Human Pepsinogen II | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
COL2A1-15C | Native Chicken COL2A1 Protein | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDH5-2435HCL | Recombinant Human RDH5 293 Cell Lysate | +Inquiry |
AHNAK2-42HCL | Recombinant Human AHNAK2 cell lysate | +Inquiry |
SLAMF8-2093MCL | Recombinant Mouse SLAMF8 cell lysate | +Inquiry |
RUNX1T1-2109HCL | Recombinant Human RUNX1T1 293 Cell Lysate | +Inquiry |
FAM98B-6336HCL | Recombinant Human FAM98B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hflK Products
Required fields are marked with *
My Review for All hflK Products
Required fields are marked with *
0
Inquiry Basket