Recombinant Full Length Protein Dif-1(Dif-1) Protein, His-Tagged
Cat.No. : | RFL17313CF |
Product Overview : | Recombinant Full Length Protein dif-1(dif-1) Protein (Q27257) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MSDVLLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKE GFFALYKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTI VMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPAS AAYLSVYEYLKKKFSGEGAQRTLSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGK YPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTLAAFRYFGIGGHPT PSTEVVPLPHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dif-1 |
Synonyms | dif-1; F49E8.5; Protein dif-1 |
UniProt ID | Q27257 |
◆ Recombinant Proteins | ||
ENPEP-274H | Active Recombinant Human ENPEP, His-tagged | +Inquiry |
AMDHD2-7754H | Recombinant Human AMDHD2 protein, GST-tagged | +Inquiry |
CLEC4G-873H | Active Recombinant Human CLEC4G Protein, His-tagged | +Inquiry |
NRARPA-9622Z | Recombinant Zebrafish NRARPA | +Inquiry |
CCL20-516H | Active Recombinant Human CCL20 Protein, MIgG2a Fc-tagged | +Inquiry |
◆ Native Proteins | ||
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K14-4507HCL | Recombinant Human MAP3K14 293 Cell Lysate | +Inquiry |
BTBD3-8397HCL | Recombinant Human BTBD3 293 Cell Lysate | +Inquiry |
TCEB2-1188HCL | Recombinant Human TCEB2 293 Cell Lysate | +Inquiry |
AP1G1-8819HCL | Recombinant Human AP1G1 293 Cell Lysate | +Inquiry |
ATP2C1-148HCL | Recombinant Human ATP2C1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dif-1 Products
Required fields are marked with *
My Review for All dif-1 Products
Required fields are marked with *
0
Inquiry Basket