Recombinant Full Length Prosthecochloris Aestuarii Upf0761 Membrane Protein Paes_1471 (Paes_1471) Protein, His-Tagged
Cat.No. : | RFL19547PF |
Product Overview : | Recombinant Full Length Prosthecochloris aestuarii UPF0761 membrane protein Paes_1471 (Paes_1471) Protein (B4S8V4) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prosthecochloris aestuarii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MPSSEHSFISVPHDALRSVRSFLAFFSKSFNRDQVLLSAGSLAFQTLLSIVPLMAVILSV LSVSPVFDSFKQYVEEFIFQNFLPASGVEVQEYLWQFISKTSSVPTIGGLSLFIIALFLI STIDHTLNRIWGVDAPRKFFQGFTLYWTVLTLGPIFIGSSLVATSYVWYNFFTQGALADV QAKTLLLLPVMNTFLAFFLLYILVPNRKVKFVHAFSGAILATLLFEFSKRWFAFYVSHVA TFEHIYGALSVIPLLFFWIYLIWVVALSGAEFVYCLGVVHPERAVVREFHPLLGISAVLL VIERISAAQSSGGFLTMNTLEDLCRSVTRMQLRRITDFLLQQNIIHKTEEGSFALSADLH TLTLYDLYAILPADLVQPKDPETSDSHFGQDLSGLEQNIIQCLQHAMHQPLAAFLNTATR TL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Paes_1471 |
Synonyms | Paes_1471; UPF0761 membrane protein Paes_1471 |
UniProt ID | B4S8V4 |
◆ Recombinant Proteins | ||
CR1L-7882C | Recombinant Chicken CR1L protein, His & T7-tagged | +Inquiry |
ARPP19-1139HF | Recombinant Full Length Human ARPP19 Protein, GST-tagged | +Inquiry |
EIF4EBP2-4999H | Recombinant Human Eukaryotic Translation Initiation Factor 4E Binding Protein 2, His-tagged | +Inquiry |
SHH-4018H | Recombinant Human SHH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SAP014A-014-4016S | Recombinant Staphylococcus aureus (strain: CDC58, other: HA-MRSA) SAP014A_014 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRK-7276HCL | Recombinant Human CRK 293 Cell Lysate | +Inquiry |
DNAJB1-6892HCL | Recombinant Human DNAJB1 293 Cell Lysate | +Inquiry |
FAM134B-6426HCL | Recombinant Human FAM134B 293 Cell Lysate | +Inquiry |
HIGD1A-5562HCL | Recombinant Human HIGD1A 293 Cell Lysate | +Inquiry |
G6PD-6079HCL | Recombinant Human G6PD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Paes_1471 Products
Required fields are marked with *
My Review for All Paes_1471 Products
Required fields are marked with *
0
Inquiry Basket