Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL14379MF |
Product Overview : | Recombinant Full Length Prolipoprotein diacylglyceryl transferase(lgt) Protein (Q9CC52) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium leprae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MTRMLPGYFPSPPRGVWHLGPLPIRAYALLIILGIVAALVVGGRCWEARGGERDVTYDIA LWAVPFGLVGGRLYHLATDWRTYFGQNGAGLGAALRIWDGGLGIWGAVALGCVGAWLGCR RHRIPLPAFGDALAPGIILAQAIGRLGNYFNQELYGRETTMPWGLEVFYRRDPAGYMDPH SLDGVSTGQLAFVVQPTFLYELIWNVLVFFALIYVDRWFTLGHGRLFATYVAAYCIGRFC VELLRDDAATHIAGIRINSFTSTFVFIGAVVYIILAPKGREEPENLCRAEYVAREIPEPE SATERATVASTYATTTAVPVSADEEFAETN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; ML1274; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | Q9CC52 |
◆ Recombinant Proteins | ||
Ifna1-429M | Active Recombinant Mouse Ifna1 Protein, His-tagged | +Inquiry |
FCGRT-1629H | Recombinant Human FCGRT protein, His & T7-tagged | +Inquiry |
BOC-296H | Recombinant Human BOC Protein | +Inquiry |
PRM1-718H | Recombinant Human PRM1 Protein, His-tagged | +Inquiry |
ADRA1A-2736H | Recombinant Human ADRA1A protein(351-420 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
Collagen Type I-02M | Native Mouse Collagen Type I (Atelocollagen) Protein | +Inquiry |
Lectin-1721P | Native Peanut Lectin | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPNS1-279HCL | Recombinant Human CAPNS1 cell lysate | +Inquiry |
Bladder-737R | Rabbit Bladder Lysate, Total Protein | +Inquiry |
HeLa-15H | HeLa Cell Nuclear Extract - Doxorubicin Stimulated | +Inquiry |
AMBRA1-8887HCL | Recombinant Human AMBRA1 293 Cell Lysate | +Inquiry |
LCMT2-4802HCL | Recombinant Human LCMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket