Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL18505CF |
Product Overview : | Recombinant Full Length Prolipoprotein diacylglyceryl transferase(lgt) Protein (Q8FP03) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Corynebacterium efficiens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MDVMTLAAIPSPPQGVWYLGPLPIRAYAMCIIAGIIVAIWLTRKRYAARGGNPEVVLDAA IVAVPAGIIGGRIYHVITDNQKYFCETCDPVDALKITNGGLGIWGAVILGGLAVWAYFRY KKIPLAPFADAVAPGVILAQAIGRLGNWFNQELYGAETDVPWALEIYYRVDENGRFAPVT GVSTGEVIATVHPTFLYEMLWNLLIFGLLIWADRRFRLGHGRVFALYVAGYTLGRFWIEQ MRTDEATMVFGMRINTLVSAVVFILAVIVFLRLGKGREAPAEVDPAYHAAQAERDDTETA GLDATTGTVPGDSPETTGKKRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; CE1990; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | Q8FP03 |
◆ Native Proteins | ||
LDL-1538H | Native Human Low-density lipoprotein | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
TF-321H | Native Human Transferrin Rhodamine | +Inquiry |
F2-90B | Active Native Bovine Thrombin | +Inquiry |
Trf-4782M | Native Mouse Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6A1-7331HCL | Recombinant Human COX6A1 293 Cell Lysate | +Inquiry |
DUSP7-516HCL | Recombinant Human DUSP7 cell lysate | +Inquiry |
ARFIP2-8749HCL | Recombinant Human ARFIP2 293 Cell Lysate | +Inquiry |
HLA-DRB5-5497HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
FAM151B-6422HCL | Recombinant Human FAM151B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket