Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL27253SF |
Product Overview : | Recombinant Full Length Prolipoprotein diacylglyceryl transferase(lgt) Protein (Q82A79) (1-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptomyces avermitilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-340) |
Form : | Lyophilized powder |
AA Sequence : | MELAYIPSPARGVLYLGPIPLRGYAFCIIIGVFVAVWLGNKRWVARGGRPGTVADIAVWA VPFGLVGGRLYHVITDYELYFSEGRDWVDAFKIWEGGLGIWGAIALGAVGAWIGCRRRGI PLPAWADAVAPGIAFAQAFGRWGNWFNQELYGRETHVPWALHITSSTDGRVPGYYHPTFL YESLWCVGVGFLVIWADRRFKLGHGRAFALYVAAYCVGRAWIEYMRVDDAHHILGVRLND WTAIAVFLLAVLYIVLSSRKRPGREEIVEPGASDTGTGADDPVDLGKDEDKATTDKATAT DTSTTTDKSTDRGKNEDENEGEDAEPSEKTESAAESAKKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; SAV_6180; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | Q82A79 |
◆ Recombinant Proteins | ||
Sms-5979M | Recombinant Mouse Sms Protein, Myc/DDK-tagged | +Inquiry |
CYP4B1-2281H | Recombinant Human CYP4B1 Protein, GST-tagged | +Inquiry |
WNT4A-3804Z | Recombinant Zebrafish WNT4A | +Inquiry |
ANGPTL5-422H | Recombinant Human ANGPTL5 protein(Asn26-Lys388), GST-tagged | +Inquiry |
Cbs-4715M | Recombinant Mouse Cbs protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-28806TH | Native Human F13A1 | +Inquiry |
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
FN1-28900TH | Native Human FN1 | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRBA2-997HCL | Recombinant Human KRBA2 cell lysate | +Inquiry |
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Prostate-401H | Human Prostate Cytoplasmic Lysate | +Inquiry |
A2M-593HCL | Recombinant Human A2M cell lysate | +Inquiry |
ZRANB2-9190HCL | Recombinant Human ZRANB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket