Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL36638MF |
Product Overview : | Recombinant Full Length Prolipoprotein diacylglyceryl transferase(lgt) Protein (Q7VEW5) (1-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-468) |
Form : | Lyophilized powder |
AA Sequence : | MRMLPSYIPSPPRGVWYLGPLPVRAYAVCVITGIIVALLIGDRRLTARGGERGMTYDIAL WAVPFGLIGGRLYHLATDWRTYFGDGGAGLAAALRIWDGGLGIWGAVTLGVMGAWIGCRR CGIPLPVLLDAVAPGVVLAQAIGRLGNYFNQELYGRETTMPWGLEIFYRRDPSGFDVPNS LDGVSTGQVAFVVQPTFLYELIWNVLVFVALIYIDRRFIIGHGRLFGFYVAFYCAGRFCV ELLRDDPATLIAGIRINSFTSTFVFIGAVVYIILAPKGREAPGALRGSEYVVDEALEREP AELAAAAVASAASAVGPVGPGEPNQPDDVAEAVKAEVAEVTDEVAAESVVQVADRDGEST PAVEETSEADIEREQPGDLAGQAPAAHQVDAEAASAAPEEPAALASEAHDETEPEVPEKA APIPDPAKPDELAVAGPGDDPAEPDGIRRQDDFSSRRRRWWRLRRRRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; BQ2027_MB1640; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | Q7VEW5 |
◆ Recombinant Proteins | ||
MSXD-8868Z | Recombinant Zebrafish MSXD | +Inquiry |
FAM131B-4504HF | Recombinant Full Length Human FAM131B Protein, GST-tagged | +Inquiry |
SAOUHSC-00899-3531S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00899 protein, His-tagged | +Inquiry |
NCF4-5939M | Recombinant Mouse NCF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPTL6-1453H | Recombinant Human ANGPTL6 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
TnI-1050H | Native Human Cardiac Troponin I | +Inquiry |
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRD-7524HCL | Recombinant Human CHRD 293 Cell Lysate | +Inquiry |
Grape-694P | Grape Lysate, Total Protein | +Inquiry |
KLRB1-4896HCL | Recombinant Human KLRB1 293 Cell Lysate | +Inquiry |
FBXO32-6297HCL | Recombinant Human FBXO32 293 Cell Lysate | +Inquiry |
PTPLAD1-1435HCL | Recombinant Human PTPLAD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket