Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL14381HF |
Product Overview : | Recombinant Full Length Prolipoprotein diacylglyceryl transferase(lgt) Protein (O06131) (1-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-468) |
Form : | Lyophilized powder |
AA Sequence : | MRMLPSYIPSPPRGVWYLGPLPVRAYAVCVITGIIVALLIGDRRLTARGGERGMTYDIAL WAVPFGLIGGRLYHLATDWRTYFGDGGAGLAAALRIWDGGLGIWGAVTLGVMGAWIGCRR CGIPLPVLLDAVAPGVVLAQAIGRLGNYFNQELYGRETTMPWGLEIFYRRDPSGFDVPNS LDGVSTGQVAFVVQPTFLYELIWNVLVFVALIYIDRRFIIGHGRLFGFYVAFYCAGRFCV ELLRDDPATLIAGIRINSFTSTFVFIGAVVYIILAPKGREAPGALRGSEYVVDEALEREP AELAAAAVASAASAVGPVGPGEPNQPDDVAEAVKAEVAEVTDEVAAESVVQVADRDGEST PAVEETSEADIEREQPGDLAGQAPAAHQVDAEAASAAPEEPAALASEAHDETEPEVPEKA APIPDPAKPDELAVAGPGDDPAEPDGIRRQDDFSSRRRRWWRLRRRRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Prolipoprotein diacylglyceryl transferase(lgt) |
UniProt ID | O06131 |
◆ Recombinant Proteins | ||
QRSL1-13769M | Recombinant Mouse QRSL1 Protein | +Inquiry |
CD8B-151H | Recombinant Human CD8B Protein, His-tagged | +Inquiry |
TIMP1-6456H | Recombinant Human TIMP1 Protein (Cys24-Ala207), C-His tagged | +Inquiry |
CCNB2-2985M | Recombinant Mouse CCNB2 Protein | +Inquiry |
TANGO2-2933H | Recombinant Human TANGO2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
ABL1-618H | Native Human C-abl Oncogene 1, Receptor Tyrosine Kinase | +Inquiry |
PLG -62R | Native Rabbit plasmin | +Inquiry |
Bilirubin-156P | Native Porcine Bilirubin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-762HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
S100A2-2860HCL | Recombinant Human S100A2 cell lysate | +Inquiry |
C12orf60-8312HCL | Recombinant Human C12orf60 293 Cell Lysate | +Inquiry |
TLR2-001MCL | Recombinant Mouse TLR2 cell lysate | +Inquiry |
SIPA1L1-1835HCL | Recombinant Human SIPA1L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Prolipoprotein diacylglyceryl transferase(lgt) Products
Required fields are marked with *
My Review for All Prolipoprotein diacylglyceryl transferase(lgt) Products
Required fields are marked with *
0
Inquiry Basket