Recombinant Full Length Prochlorococcus Marinus Protein Crcb Homolog 2(Crcb2) Protein, His-Tagged
Cat.No. : | RFL30229PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus Protein CrcB homolog 2(crcB2) Protein (Q46IH7) (1-124aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-124) |
Form : | Lyophilized powder |
AA Sequence : | MSDILFVSIGAILGANIRFQIHHKLGNLNLDKGFLILIINTFASFGLGLFLSLVEQFRAF TYSYQLILFFSIGFFGSLSTFSSFVYDLFDLCLQLELFRALKLFIISVSIGIIAFAFGLF LGTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crcB2 |
Synonyms | crcB2; PMN2A_1211; Putative fluoride ion transporter CrcB 2 |
UniProt ID | Q46IH7 |
◆ Native Proteins | ||
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
Fgg -69R | Native Rat Fibrinogen | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBL4B-1875HCL | Recombinant Human UBL4B cell lysate | +Inquiry |
HA-2345HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
C7orf42-7966HCL | Recombinant Human C7orf42 293 Cell Lysate | +Inquiry |
IRF5-5163HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
Spleen-472M | Mouse Spleen Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All crcB2 Products
Required fields are marked with *
My Review for All crcB2 Products
Required fields are marked with *
0
Inquiry Basket