Recombinant Full Length Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL34252SF |
Product Overview : | Recombinant Full Length Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (P0A198) (1-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-546) |
Form : | Lyophilized powder |
AA Sequence : | MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVEA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPGWLMVGGVVVWLV GWRKTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; aarF; STY3587; t3325; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | P0A198 |
◆ Recombinant Proteins | ||
RIPOR2-4627HF | Recombinant Full Length Human RIPOR2 Protein, GST-tagged | +Inquiry |
TNF-1914H | Recombinant Human Tumor Necrosis Factor, HQ-tagged | +Inquiry |
LHCGR-5067M | Recombinant Mouse LHCGR Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL19270MF | Recombinant Full Length Macaca Fascicularis Gap Junction Delta-4 Protein(Gjd4) Protein, His-Tagged | +Inquiry |
CPSF4-1232R | Recombinant Rat CPSF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LOC100514666-45P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Collagen-317B | Native Bovine Collagen Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR3K-3020HCL | Recombinant Human POLR3K 293 Cell Lysate | +Inquiry |
LY6G6D-4599HCL | Recombinant Human LY6G6D 293 Cell Lysate | +Inquiry |
BEST1-1910HCL | Recombinant Human BEST1 cell lysate | +Inquiry |
HMGCR-802HCL | Recombinant Human HMGCR cell lysate | +Inquiry |
ZFP42-1977HCL | Recombinant Human ZFP42 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket