Recombinant Full Length Probable Ni/Fe-Hydrogenase B-Type Cytochrome Subunit(Hoxz) Protein, His-Tagged
Cat.No. : | RFL33231AF |
Product Overview : | Recombinant Full Length Probable Ni/Fe-hydrogenase B-type cytochrome subunit(hoxZ) Protein (P23000) (1-240aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Azotobacter vinelandii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-240) |
Form : | Lyophilized powder |
AA Sequence : | MALEKSLETGDGQEKVRKQTAVYVYEAPLRLWHWVTALSIVVLGVTGYFIGAPLPTMPGE AMDNYLMGYIRFAHFAAGYVLAIGFLGRVYWAFVGNHHARELFLVPVHRKAWWKELWHEV RWYLFLEKTPKKYIGHNPLGQLAMFCFFVVGAVFMSVTGFALYAEGLGRDSWADRLFGWV IPLFGQSQDVHTWHHLGMWYLVVFVMVHVYLAVREDIVSRQSLISTMVGGWRMFKDDRPD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hoxZ |
Synonyms | hoxZ; Probable Ni/Fe-hydrogenase B-type cytochrome subunit |
UniProt ID | P23000 |
◆ Recombinant Proteins | ||
METTL21A-5497M | Recombinant Mouse METTL21A Protein, His (Fc)-Avi-tagged | +Inquiry |
IL4RA-0295C | Active Recombinant Cynomolgus / Rhesus macaque IL4RA protein, His-tagged | +Inquiry |
Ddr1-1151M | Recombinant Mouse Ddr1 Protein(Asp22-Ala415), His-tagged | +Inquiry |
LYPD6--1685H | Recombinant Human LYPD6 Protein (23-171 aa), His-tagged | +Inquiry |
DOLK-1314R | Recombinant Rhesus monkey DOLK Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
gp125-261V | Native EBV Viral Capsid gp125 Protein | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-29H | Human Liver Tumor Tissue Lysate | +Inquiry |
CALM3-7888HCL | Recombinant Human CALM3 293 Cell Lysate | +Inquiry |
LAT-4817HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
PCDH1-1292HCL | Recombinant Human PCDH1 cell lysate | +Inquiry |
ZFP91-750HCL | Recombinant Human ZFP91 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hoxZ Products
Required fields are marked with *
My Review for All hoxZ Products
Required fields are marked with *
0
Inquiry Basket