Recombinant Full Length Probable Long-Chain-Fatty-Acid--Coa Ligase Fadd23(Fadd23) Protein, His-Tagged
Cat.No. : | RFL23995HF |
Product Overview : | Recombinant Full Length Probable long-chain-fatty-acid--CoA ligase FadD23(fadD23) Protein (O07797) (1-584aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-584) |
Form : | Lyophilized powder |
AA Sequence : | MVSLSIPSMLRQCVNLHPDGTAFTYIDYERDSEGISESLTWSQVYRRTLNVAAEVRRHAA IGDRAVILAPQGLDYIVAFLGALQAGLIAVPLSAPLGGASDERVDAVVRDAKPNVVLTTS AIMGDVVPRVTPPPGIASPPTVAVDQLDLDSPIRSNIVDDSLQTTAYLQYTSGSTRTPAG VMITYKNILANFQQMISAYFADTGAVPPLDLFIMSWLPFYHDMGLVLGVCAPIIVGCGAV LTSPVAFLQRPARWLQLMAREGQAFSAAPNFAFELTAAKAIDDDLAGLDLGRIKTILCGS ERVHPATLKRFVDRFSRFNLREFAIRPAYGLAEATVYVATSQAGQPPEIRYFEPHELSAG QAKPCATGAGTALVSYPLPQSPIVRIVDPNTNTECPPGTIGEIWVHGDNVAGGYWEKPDE TERTFGGALVAPSAGTPVGPWLRTGDSGFVSEDKFFIIGRIKDLLIVYGRNHSPDDIEAT IQEITRGRCAAIAVPSNGVEKLVAIVELNNRGNLDTERLSFVTREVTSAISTSHGLSVSD LVLVAPGSIPITTSGKVRRAECVKLYRHNEFTRLDAKPLQASDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Probable long-chain-fatty-acid--CoA ligase FadD23(fadD23) |
UniProt ID | O07797 |
◆ Recombinant Proteins | ||
DCDC2A-4345M | Recombinant Mouse DCDC2A Protein | +Inquiry |
CD86-2228HAF647 | Recombinant Human CD86 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
GDI1-975H | Recombinant Human GDI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17756EF | Recombinant Full Length Escherichia Coli Potassium-Transporting Atpase C Chain(Kdpc) Protein, His-Tagged | +Inquiry |
S-5484S | Recombinant SARS-CoV-2 NTD Protein (Ser13-Leu303), C-His tagged | +Inquiry |
◆ Native Proteins | ||
HSV1Ag-354H | Active Native Herpes Simplex Virus 1 Protein | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EL4-01HL | Human EL4 lysate | +Inquiry |
PLB1-1369HCL | Recombinant Human PLB1 cell lysate | +Inquiry |
HA-718HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
TBCE-1216HCL | Recombinant Human TBCE 293 Cell Lysate | +Inquiry |
UBE2D3-585HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Probable long-chain-fatty-acid--CoA ligase FadD23(fadD23) Products
Required fields are marked with *
My Review for All Probable long-chain-fatty-acid--CoA ligase FadD23(fadD23) Products
Required fields are marked with *
0
Inquiry Basket