Recombinant Full Length Probable G-Protein Coupled Receptor C56G3.1(C56G3.1) Protein, His-Tagged
Cat.No. : | RFL23067CF |
Product Overview : | Recombinant Full Length Probable G-protein coupled receptor C56G3.1(C56G3.1) Protein (Q18904) (1-490aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-490) |
Form : | Lyophilized powder |
AA Sequence : | MEVKDIDNYCDRGISPNASNYLTYPFDGLCLQKFFYQLQTSLRRFTPYEEIIYTTVYIII SVAAVIGNGLVIMAVVRKKTMRTNRNVLILNLALSNLILAITNIPFLWLPSIDFEFPYSR FFCKFANVLPGSNIYCSTLTISVMAIDRYYSVKKLKIASNRKQCFHAVLVSLAIWIVSFI LSLPLLLYYETSMLYVMREIRVVDQSGQEVIRSYGWRQCRLVSAGRLPDITQSIQLLMSI LQVAFLYIVPLFVLSIFNVKLTRFLKTNANKMSKTRAPPKRFDRSDSHHNSLKNNNNHTS SLRSPSMPSIRSSITERNKTNQRTNRTTSLLIAMAGSYAALWFPFTLITFLIDFELIINQ DYVNLVERIDQTCKMVSMLSICVNPFLYGFLNTNFRHEFSDIYYRYIRCETKSQPAGRFH HDVSSIAHHRQDSVYNDEATLLTTGRQSNGKDGSSSPIGFRSSVRVCSGQTKMIGDRIVL DDDIEKDSFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | npr-8 |
Synonyms | npr-8; C56G3.1; Probable G-protein coupled receptor npr-8 |
UniProt ID | Q18904 |
◆ Recombinant Proteins | ||
PRKAR2B-13360M | Recombinant Mouse PRKAR2B Protein | +Inquiry |
RFL31557CF | Recombinant Full Length Chlamydophila Caviae Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
NP-1740M | Recombinant Machupo virus (MARU 249121) NP Protein | +Inquiry |
CNOT6-764R | Recombinant Rhesus Macaque CNOT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
OXT-9587Z | Recombinant Zebrafish OXT | +Inquiry |
◆ Native Proteins | ||
PLAT-30946TH | Native Human PLAT | +Inquiry |
ApoA4-68H | Native Human Apolipoprotein AIV | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM8A-927HCL | Recombinant Human TMEM8A 293 Cell Lysate | +Inquiry |
GLO1-5899HCL | Recombinant Human GLO1 293 Cell Lysate | +Inquiry |
OXR1-462HCL | Recombinant Human OXR1 lysate | +Inquiry |
HAUS7-5627HCL | Recombinant Human HAUS7 293 Cell Lysate | +Inquiry |
ATL2-122HCL | Recombinant Human ATL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All npr-8 Products
Required fields are marked with *
My Review for All npr-8 Products
Required fields are marked with *
0
Inquiry Basket