Recombinant Full Length Probable Disulfide Formation Protein Protein, His-Tagged
Cat.No. : | RFL28195PF |
Product Overview : | Recombinant Full Length Probable disulfide formation protein Protein (Q8GHM3) (1-144aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas resinovorans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-144) |
Form : | Lyophilized powder |
AA Sequence : | MNPQPSGMTWNLLLLTWLVALISTLSALFIGEVMGQAPCVLCWFQRAFMFPLTVILAIAC YRSDFTVWRYALPLTVIGAALAFVHTLLYAGLIPQPIQPCTATGPSCSGAGMTLFGVVPL PALALFAFIIIAILLIIIRRRTTP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Probable disulfide formation protein |
Synonyms | Probable disulfide formation protein; Disulfide oxidoreductase; Thiol-disulfide oxidoreductase |
UniProt ID | Q8GHM3 |
◆ Recombinant Proteins | ||
MYOD1-166H | Recombinant Human MYOD1, GST-tagged | +Inquiry |
CXorf21-2187H | Recombinant Human CXorf21 Protein, GST-tagged | +Inquiry |
CBR3-10763H | Recombinant Human CBR3, GST-tagged | +Inquiry |
GPER1-59HCL | Recombinant Human GPER1 Over-expression Lysate, C-Myc/DDK tagged | +Inquiry |
ACY1-8280Z | Recombinant Zebrafish ACY1 | +Inquiry |
◆ Native Proteins | ||
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
ALB-37G | Native Goat Albumin (ALB) Protein | +Inquiry |
HDL-1539H | Native Human High-density lipoprotein | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cerebral Meninges-75R | Rhesus monkey Cerebral Meninges Lysate | +Inquiry |
ARSK-8673HCL | Recombinant Human ARSK 293 Cell Lysate | +Inquiry |
XRCC2-257HCL | Recombinant Human XRCC2 293 Cell Lysate | +Inquiry |
PCTP-3368HCL | Recombinant Human PCTP 293 Cell Lysate | +Inquiry |
Cecum-487C | Chicken Cecum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Probable disulfide formation protein Products
Required fields are marked with *
My Review for All Probable disulfide formation protein Products
Required fields are marked with *
0
Inquiry Basket