Recombinant Full Length Probable Cadmium-Transporting Atpase(Cada) Protein, His-Tagged
Cat.No. : | RFL10951LF |
Product Overview : | Recombinant Full Length Probable cadmium-transporting ATPase(cadA) Protein (Q60048) (1-711aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Listeria monocytogenes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-711) |
Form : | Lyophilized powder |
AA Sequence : | MAEKTVYRVDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEASIQQVEQAGAF EHLKIIPEKESFTDPEHFTDHQSFIRKNWRLLLSGLFIAVGYASQIMNGEDFYLTNALFI FAIFIGGYSLFKEGFKNLLKFEFTMETLMTIAIIGAAFIGEWAEGSIVVILFAVSEALER YSMDKARQSIRSLMDIAPKEALVRRSGTDRMVHVDDIQIGDIMIIKPGQKIAMDGHVVKG YSAVNQAAITGESIPVEKNIDDSVFAGTLNEEGLLEVAVTKRVEDTTISKIIHLVEEAQG ERAPAQAFVDTFAKYYTPAIIVIAALIATVPPLLFGGNWETWVYQGLSVLVVGCPCALVV STPVAIVTAIGNAAKNGVLVKGGVYLEEIGGLKAIAFDKTGTLTKGVPVVTDYIELTEAT NIQHNKNYIIMAALEQLSQHPLASAIIKYGETREMDLTSINVNDFTSITGKGIRGTVDGN TYYVGSPVLFKELLASQFTDSIHRQVSDLQLKGKTAMLFGTNQKLISIVAVADEVRSSSQ HVIKRLHELGIEKTIMLTGDNQATAQAIGQQVGVSEIEGELMPQDKLDYIKQLKINFGKV AMVGDGINDAPALAAATVGIAMGGAGTDTAIETADVALMGDDLQKLPFTVKLSRKTLQII KQNITFSLVIKLIALLLVIPGWLTLWIAIMADMGATLLVTLNGLRLMKVKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cadA |
Synonyms | cadA; Probable cadmium-transporting ATPase; Cadmium-efflux ATPase |
UniProt ID | Q60048 |
◆ Recombinant Proteins | ||
UBASH3A-2813H | Recombinant Human UBASH3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYDA-2030B | Recombinant Bacillus subtilis CYDA protein, His-tagged | +Inquiry |
SCO3649-1191S | Recombinant Streptomyces coelicolor A3(2) SCO3649 protein, His-tagged | +Inquiry |
DNM1B-8201Z | Recombinant Zebrafish DNM1B | +Inquiry |
COX20-2002HF | Recombinant Full Length Human COX20 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C4B-1846H | Native Human C4B Protein | +Inquiry |
Fgb -68R | Native Rat Fibrinogen | +Inquiry |
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
Artery-22H | Human Artery Cytoplasmic Lysate | +Inquiry |
GRK6-622HCL | Recombinant Human GRK6 cell lysate | +Inquiry |
GSTO2-5710HCL | Recombinant Human GSTO2 293 Cell Lysate | +Inquiry |
CDH13-802RCL | Recombinant Rat CDH13 cell lysate | +Inquiry |
TRPM8-737HCL | Recombinant Human TRPM8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cadA Products
Required fields are marked with *
My Review for All cadA Products
Required fields are marked with *
0
Inquiry Basket