Recombinant Full Length Probable Adenylyltransferase/Sulfurtransferase Moez(Moez) Protein, His-Tagged
Cat.No. : | RFL30056HF |
Product Overview : | Recombinant Full Length Probable adenylyltransferase/sulfurtransferase MoeZ(moeZ) Protein (Q7D5X9) (1-392aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-392) |
Form : | Lyophilized powder |
AA Sequence : | MSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLY LAAAGVGTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELR LAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAP DGLGVNYRDLYPEPPPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLL VYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDS GRKLALIDVRDPVEWDIVHIDGAQLIPKSLINSGEGLAKLPQDRTAVLYCKTGVRSAEAL AAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Probable adenylyltransferase/sulfurtransferase MoeZ(moeZ) |
UniProt ID | Q7D5X9 |
◆ Native Proteins | ||
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
PGC-8318H | Native Human PGC | +Inquiry |
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
GS-32 | Active Native Glutamine synthetase | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA2-1538HCL | Recombinant Human SPATA2 293 Cell Lysate | +Inquiry |
GATAD1-6008HCL | Recombinant Human GATAD1 293 Cell Lysate | +Inquiry |
DIRC1-6920HCL | Recombinant Human DIRC1 293 Cell Lysate | +Inquiry |
ZNF346-2016HCL | Recombinant Human ZNF346 cell lysate | +Inquiry |
ZNF653-2069HCL | Recombinant Human ZNF653 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Probable adenylyltransferase/sulfurtransferase MoeZ(moeZ) Products
Required fields are marked with *
My Review for All Probable adenylyltransferase/sulfurtransferase MoeZ(moeZ) Products
Required fields are marked with *
0
Inquiry Basket