Recombinant Full Length Prion-Like-(Q/N-Rich) Domain-Bearing Protein 25 Protein, His-Tagged
Cat.No. : | RFL29955CF |
Product Overview : | Recombinant Full Length Prion-like-(Q/N-rich) domain-bearing protein 25 Protein (P41951) (1-672aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-672) |
Form : | Lyophilized powder |
AA Sequence : | MEETCSESPKESNIISFIWHKLLKRVPPPIMICLFFLLLQIFVISVVSQCPPGLTPLFSN SNFNQPLTCTPQDACSCYSSSGSSRFGTICQYASTYNNYICCYSTNTQCGSNSSPQVSAS GQVVTCSTNTQCASGYTCNNGACCPNTNSNTCSSNGNNGCLAGQTMVNGQCYNSVNIGSA CQSTQQCLGGSQCQNNICQCYSGYVNVNQQCVISNGLNCQLGTVSYNSQCITLASPGQNC QTSSQCIDNSVCMNQMCTCNNNYRLVYGYCVPITSSICQQTQTLVNNQCVLLSIVGETCI ANQQCVGGAMCNSGTCQCTNGATAMYGYCISSSSSSCNSNQVSINGMCYNTVQVGGSCSF SQQCLNNAVCTNNICVSTFCSVSCSTNQVCISNQCYNYVSIGSQCVGSQQCLSNSQCISS ICQCPQGTQQSNGVCTGNNNNNNQCQPNQVLINNQCYNTVSIGFQCQFPQQCLGNSQCMN SMCQCPTGSTNVNGYCQGGSNGQCNSNQVLINNQCYNTVSIGFQCQFAQQCLGNSQCLNS ICQCPSGSSNVNGYCQGGSNGQCNSNQVYYNNQCYNTVPIGSQCQITQQCLGNSQCMNSF CQCPSGTTNVNNFCTTSSSSSNLCSAGQTVQLDSSNQPINCLVSTCPNNSFCQYSSSGQR YVCCRSTSGKKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pqn-25 |
Synonyms | pqn-25; D1044.3; Prion-like-(Q/N-rich domain-bearing protein 25; Glutamine/asparagine-rich protein pqn-25 |
UniProt ID | P41951 |
◆ Recombinant Proteins | ||
GRP10-1705C | Recombinant Canine GRP10 protein, hFc-tagged | +Inquiry |
SDHD-7970M | Recombinant Mouse SDHD Protein, His (Fc)-Avi-tagged | +Inquiry |
NLRP3-3987H | Recombinant Human NLRP3 Protein (Met1-Arg157), N-His tagged | +Inquiry |
ELL-2741M | Recombinant Mouse ELL Protein, His (Fc)-Avi-tagged | +Inquiry |
AFP-0455H | Recombinant Human AFP Protein (Leu260-Val609), N-His-tagged | +Inquiry |
◆ Native Proteins | ||
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
Tf-392R | Native Rat Transferrin | +Inquiry |
Lectin-1827P | Active Native Pisum Sativum Agglutinin Protein, Agarose bound | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
THY1-952CCL | Recombinant Cynomolgus THY1 cell lysate | +Inquiry |
CETP-7559HCL | Recombinant Human CETP 293 Cell Lysate | +Inquiry |
RNF14-2296HCL | Recombinant Human RNF14 293 Cell Lysate | +Inquiry |
SLC7A4-1697HCL | Recombinant Human SLC7A4 293 Cell Lysate | +Inquiry |
TXNL1-619HCL | Recombinant Human TXNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pqn-25 Products
Required fields are marked with *
My Review for All pqn-25 Products
Required fields are marked with *
0
Inquiry Basket