Recombinant Full Length Populus Alba Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL3496PF |
Product Overview : | Recombinant Full Length Populus alba Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q14FG1) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Populus alba (White poplar) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILT KPFAWARRALVWSGEAYLSYSLGALAVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q14FG1 |
◆ Recombinant Proteins | ||
IGFBP7-55H | Recombinant Human IGFBP7 protein | +Inquiry |
RFL12283MF | Recombinant Full Length Mouse Androgen-Induced Gene 1 Protein(Aig1) Protein, His-Tagged | +Inquiry |
RACGAP1-5834H | Recombinant Human RACGAP1 Protein (Met106-Trp539), N-GST tagged | +Inquiry |
RNF183-14324M | Recombinant Mouse RNF183 Protein | +Inquiry |
MPXV-0647 | Recombinant Monkeypox Virus N2R Protein | +Inquiry |
◆ Native Proteins | ||
TF-31156TH | Native Human TF | +Inquiry |
IgM-210R | Native Rabbit IgM | +Inquiry |
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
TF-132B | Native Bovine Transferrin | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf40-199HCL | Recombinant Human C12orf40 cell lysate | +Inquiry |
SNX5-1587HCL | Recombinant Human SNX5 293 Cell Lysate | +Inquiry |
UBE2D3-585HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
K 563-258H | Human K 562 Membrane Lysate | +Inquiry |
SUCNR1-1364HCL | Recombinant Human SUCNR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket