Recombinant Full Length Populus Alba Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL18755PF |
Product Overview : | Recombinant Full Length Populus alba NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q14FA3) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Populus alba (White poplar) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTTVQAINSFSRLKSLNEVYGIIWMLVPILTLVLGITIGILVIVWLEREISAGIQQ RIGPEYAGPFGVLQALADGTKLLFKENLFPSRGDTRLFSIGPSIAVISTLLSYSVIPFGY HFVLADLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFGGWNLWRQPIGFIIFFISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVAVLYLGGWNISIPYISVPEFFDFEINKVG RVFGTTMGILITLVKTYLFLFIPITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSS QLFSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q14FA3 |
◆ Recombinant Proteins | ||
CSF1R-1085HFL | Recombinant Full Length Human CSF1R Protein, C-Flag-tagged | +Inquiry |
FGB-2871H | Recombinant Human FGB Protein (Thr108-Gln491), N-His tagged | +Inquiry |
CHRM2-2672H | Recombinant Human CHRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
REPA-3455S | Recombinant Staphylococcus aureus (strain: WB43S, other: ST73-MRSA-IVa (2B)) REPA protein, His-tagged | +Inquiry |
FAM73B-3089M | Recombinant Mouse FAM73B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C4B-1846H | Native Human C4B Protein | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
ARPC2-01P | Native Porcine ARPC2 Protein (Arp2/3 Protein Complex) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZWINT-9179HCL | Recombinant Human ZWINT 293 Cell Lysate | +Inquiry |
IL7R-2595HCL | Recombinant Human IL7R cell lysate | +Inquiry |
HA-008H7N9HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
OVOL2-1264HCL | Recombinant Human OVOL2 cell lysate | +Inquiry |
HMGN4-5471HCL | Recombinant Human HMGN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket