Recombinant Full Length Pongo Pygmaeus Histamine H1 Receptor(Hrh1) Protein, His-Tagged
Cat.No. : | RFL7763PF |
Product Overview : | Recombinant Full Length Pongo pygmaeus Histamine H1 receptor(HRH1) Protein (Q9N2B0) (1-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Pygmaeus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-487) |
Form : | Lyophilized powder |
AA Sequence : | MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTISLVTVGLNLLVLYAVRSERKLHT VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFRQQISVRREDKC ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVQKHCQHRELINGSLPSFSEIKLR PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDGEVDKL HCFPLDIVQMQTVAEGSSRDYVAINQSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK RILHIRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HRH1 |
Synonyms | HRH1; Histamine H1 receptor; H1R; HH1R |
UniProt ID | Q9N2B0 |
◆ Recombinant Proteins | ||
HRH1-786H | Recombinant Human HRH1 Protein, Flag-His-tagged | +Inquiry |
HRH1-2134H | Recombinant Human HRH1 Protein (211-416 aa), His-tagged | +Inquiry |
HRH1-3664HF | Recombinant Full Length Human HRH1 Protein, GST-tagged | +Inquiry |
HRH1-1046H | Recombinant Human Histamine Receptor H 1 | +Inquiry |
RFL4498MF | Recombinant Full Length Mouse Histamine H1 Receptor(Hrh1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HRH1-5392HCL | Recombinant Human HRH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HRH1 Products
Required fields are marked with *
My Review for All HRH1 Products
Required fields are marked with *
0
Inquiry Basket