Recombinant Full Length Pongo Abelii Zinc Transporter Slc39A7(Slc39A7) Protein, His-Tagged
Cat.No. : | RFL429PF |
Product Overview : | Recombinant Full Length Pongo abelii Zinc transporter SLC39A7(SLC39A7) Protein (Q5RFD5) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MARGLGAPHWVAVGLLTWATLGLLVAELGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSH AHGHGHTHESIWHGHTHGHDHGHSHGDLHHGHSHGHSHESLYHRGHGHDNEHSRGGYGES GAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGL LGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHV KGGHGHSHGHGHAHSHTHGSHGHGRQECSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGP VRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEV PHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVVMMVLIAHLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC39A7 |
Synonyms | SLC39A7; Zinc transporter SLC39A7; Histidine-rich membrane protein Ke4; Solute carrier family 39 member 7; Zrt-, Irt-like protein 7; ZIP7 |
UniProt ID | Q5RFD5 |
◆ Recombinant Proteins | ||
Slc39a7-1087M | Recombinant Mouse Slc39a7 Protein, MYC/DDK-tagged | +Inquiry |
SLC39A7-4291R | Recombinant Rhesus monkey SLC39A7 Protein, His-tagged | +Inquiry |
RFL14096MF | Recombinant Full Length Mouse Zinc Transporter Slc39A7(Slc39A7) Protein, His-Tagged | +Inquiry |
SLC39A7-657H | Recombinant Human SLC39A7 Protein (1-469 aa), GST-tagged | +Inquiry |
RFL24285HF | Recombinant Full Length Human Zinc Transporter Slc39A7(Slc39A7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A7-1717HCL | Recombinant Human SLC39A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC39A7 Products
Required fields are marked with *
My Review for All SLC39A7 Products
Required fields are marked with *
0
Inquiry Basket