Recombinant Full Length Pongo Abelii Transmembrane Protein 41B(Tmem41B) Protein, His-Tagged
Cat.No. : | RFL32366PF |
Product Overview : | Recombinant Full Length Pongo abelii Transmembrane protein 41B(TMEM41B) Protein (Q5RBZ8) (1-291aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-291) |
Form : | Lyophilized powder |
AA Sequence : | MAKGRVAERSQMGADHTTPVGDGAAGTRGPAAPGSRDYQKEKSWAEAGSARMSLLILVSI FLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFAT YIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLT EKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP SFVAIKAGTTLHQPTTAGEAVSWNSIFILMILAVLSILPAIFQKKLKQKFE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM41B |
Synonyms | TMEM41B; Transmembrane protein 41B |
UniProt ID | Q5RBZ8 |
◆ Native Proteins | ||
AGE-39 | Active Native Human Advanced Glycation End Product (AGE) Protein | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
DPP4-31H | Active Native Human DPP4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF3-8631HCL | Recombinant Human ATF3 293 Cell Lysate | +Inquiry |
CASP3-7839HCL | Recombinant Human CASP3 293 Cell Lysate | +Inquiry |
GLTP-5893HCL | Recombinant Human GLTP 293 Cell Lysate | +Inquiry |
KLHL8-945HCL | Recombinant Human KLHL8 cell lysate | +Inquiry |
ELAC1-6639HCL | Recombinant Human ELAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM41B Products
Required fields are marked with *
My Review for All TMEM41B Products
Required fields are marked with *
0
Inquiry Basket