Recombinant Full Length Pongo Abelii Cytochrome P450 4V2(Cyp4V2) Protein, His-Tagged
Cat.No. : | RFL34569PF |
Product Overview : | Recombinant Full Length Pongo abelii Cytochrome P450 4V2(CYP4V2) Protein (Q5RCN6) (1-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-525) |
Form : | Lyophilized powder |
AA Sequence : | MAGLWLGLVWQKLLLWGAASAVSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLV GHALLMKRDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSRQIDK SSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKH VNQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSQMIFQRIKMPWLW LDLWYLMFKEGWEHEKGLKILHTFTNNVIAERANEMNADEDCRGVGRGSAPSKNKRRAFL DLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGCNPEVQQKVDHELD DVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAV IIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI LSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRDADEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP4V2 |
Synonyms | CYP4V2; Cytochrome P450 4V2; Docosahexaenoic acid omega-hydroxylase CYP4V2; Long-chain fatty acid omega-monooxygenase |
UniProt ID | Q5RCN6 |
◆ Recombinant Proteins | ||
RFL16376MF | Recombinant Full Length Mouse Cytochrome P450 4V2(Cyp4V2) Protein, His-Tagged | +Inquiry |
CYP4V2-990R | Recombinant Rhesus Macaque CYP4V2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP4V2-1165R | Recombinant Rhesus monkey CYP4V2 Protein, His-tagged | +Inquiry |
CYP4V2-2287H | Recombinant Human CYP4V2 Protein, GST-tagged | +Inquiry |
RFL36768HF | Recombinant Full Length Human Cytochrome P450 4V2(Cyp4V2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP4V2-440HCL | Recombinant Human CYP4V2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP4V2 Products
Required fields are marked with *
My Review for All CYP4V2 Products
Required fields are marked with *
0
Inquiry Basket