Recombinant Full Length Pongo Abelii Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G2) Protein, His-Tagged

• Cat.No.: RFL1389PF
• Product Overview: Recombinant Full Length Pongo abelii ATP synthase lipid-binding protein, mitochondrial(ATP5G2) Protein (Q5RAP9) (67-141aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length of Mature Protein (67-141)
• AA Sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: ATP5G2
• Synonyms: ATP5MC2; ATP5G2; ATP synthase F(0 complex subunit C2, mitochondrial; ATP synthase lipid-binding protein; ATP synthase membrane subunit c locus 2; ATP synthase proteolipid P2; ATPase protein 9; ATPase subunit c
• UniProt ID: Q5RAP9