Recombinant Full Length Pongo Abelii 3-Hydroxyacyl-Coa Dehydratase 3(Ptplad1) Protein, His-Tagged
Cat.No. : | RFL31171PF |
Product Overview : | Recombinant Full Length Pongo abelii 3-hydroxyacyl-CoA dehydratase 3(PTPLAD1) Protein (Q5NVQ2) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MAMENQVLTPHVYWAQRHRELYLRVELSDVQNPAISTTENVLHFKAQGHGAKGDNVYEFH LEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEM ELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKE SFYDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEM QNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWEVLTWLRYTLWIPLYPLGCLAEAVSVV QSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKK KKIH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HACD3 |
Synonyms | HACD3; PTPLAD1; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 3; 3-hydroxyacyl-CoA dehydratase 3; HACD3; Protein-tyrosine phosphatase-like A domain-containing protein 1 |
UniProt ID | Q5NVQ2 |
◆ Recombinant Proteins | ||
TPRG1L-4738R | Recombinant Rhesus Macaque TPRG1L Protein, His (Fc)-Avi-tagged | +Inquiry |
VOPP1-4290H | Recombinant Human VOPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YDGD-3586B | Recombinant Bacillus subtilis YDGD protein, His-tagged | +Inquiry |
AYP1020-RS04405-5011S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS04405 protein, His-tagged | +Inquiry |
Spike-344V | Recombinant COVID-19 Spike RBD (K417N) protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
GPCP-28 | Active Native Glycerophosphocholine phosphodiesterase | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FEM1B-6266HCL | Recombinant Human FEM1B 293 Cell Lysate | +Inquiry |
CFL1-7555HCL | Recombinant Human CFL1 293 Cell Lysate | +Inquiry |
TIMP3-1064HCL | Recombinant Human TIMP3 293 Cell Lysate | +Inquiry |
Testis-762B | Bovine Testis Membrane Lysate, Total Protein | +Inquiry |
ZC3H15-206HCL | Recombinant Human ZC3H15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HACD3 Products
Required fields are marked with *
My Review for All HACD3 Products
Required fields are marked with *
0
Inquiry Basket