Recombinant Full Length Pleuronectes Platessa Udp-Glucuronosyltransferase(Ugt3) Protein, His-Tagged
Cat.No. : | RFL20811PF |
Product Overview : | Recombinant Full Length Pleuronectes platessa UDP-glucuronosyltransferase(ugt3) Protein (Q91280) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pleuronectes platessa (European plaice) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | LVPESSLFMHQSEDYETEVYPVSFTTEEMDATHKQLKDGLFLKQPDWTEYYVNIMRFVNF TSIHLRGCENLLENQPLMSRMRGMGFDIVLTDPFFPCGALVGNIFSIPVVNFLRGLPCGL DMKVNKCPSPPSYIPVPYSGNTNIMTFPQRVINMAMTVVESYQCSLLYGHYDEMVSKYVG NNMDYRTLLSHGALWLIRNEFTLDWPRPLLPNMVLIGGINCAEKKKNASLPADLEEFVQG SGDDGFIIFTLGSMLPDMPQEKAQHFLDAFRQIPQRVVWRYAGDPPKGLPKNVRLMKWLP QKELLAHPKAKLFLTHGGSHSVYEGICNAVPMLMFPLFAEQGDNGLRMVTRGAAETLNIY DVTSDNLLAALNKILKNKSYKEKITEMSQIHHDRPVAPLDLAIFWTEFVIRHKGASHLRV AAHELNWIQYHSLDVFGFILLILLTVLWVTLKCCLFCTRRCCRRGTAKTKSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ugt3 |
Synonyms | ugt3; UDP-glucuronosyltransferase; UDPGT; Fragment |
UniProt ID | Q91280 |
◆ Recombinant Proteins | ||
BIRC3-27246TH | Recombinant Human BIRC3 | +Inquiry |
HPGDS-6569C | Recombinant Chicken HPGDS | +Inquiry |
RFL14030PF | Recombinant Full Length Prochlorococcus Marinus Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged | +Inquiry |
Nes-2707M | Recombinant Mouse Nes protein, His & GST-tagged | +Inquiry |
RCBTB2-4633R | Recombinant Rat RCBTB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
Lectin-1800L | Active Native Lycopersicon Esculentum Lectin Protein, Agarose bound | +Inquiry |
Chylomicrons-193H | Native Human Chymotrypsin | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
Pancreas-361H | Human Pancreas Lupus Lysate | +Inquiry |
ZNF785-755HCL | Recombinant Human ZNF785 lysate | +Inquiry |
AFF4-8988HCL | Recombinant Human AFF4 293 Cell Lysate | +Inquiry |
CSNK1A1-617HCL | Recombinant Human CSNK1A1 cell lysate | +Inquiry |
RIBC2-2342HCL | Recombinant Human RIBC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ugt3 Products
Required fields are marked with *
My Review for All ugt3 Products
Required fields are marked with *
0
Inquiry Basket