Recombinant Full Length Pinus Koraiensis Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged
Cat.No. : | RFL23499PF |
Product Overview : | Recombinant Full Length Pinus koraiensis Cytochrome b6-f complex subunit 4(petD) Protein (Q85X03) (1-189aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pinus koraiensis (Korean pine) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-189) |
Form : | Lyophilized powder |
AA Sequence : | MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEPS MIGEPANPFATPLEILPEWYLFPVFQILRTVPNQILRTVPNKLLGVLLMASVPAGSLTVP FLENVNQFQNPFRRPVATTVSLIGTAVALWLGIGAALPIDESLTLGLFQSNLIQLSNIKI FQIFFFSYI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petD |
Synonyms | petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide |
UniProt ID | Q85X03 |
◆ Recombinant Proteins | ||
RNF181-3753R | Recombinant Rhesus Macaque RNF181 Protein, His (Fc)-Avi-tagged | +Inquiry |
LOX-3432R | Recombinant Rat LOX Protein | +Inquiry |
HCV2_gp1-117H | Recombinant Hepatitis C Virus HCV2_gp1 protein, His-tagged | +Inquiry |
Pf4-4803M | Active Recombinant Mouse Pf4 Protein | +Inquiry |
SAP073A-004-2244S | Recombinant Staphylococcus aureus (strain: 207, other: CA-MSSA) SAP073A_004 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FG-163B | Native Bovine fibrinogen | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
CRP-8374H | Native Human CRP | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATAD3B-143HCL | Recombinant Human ATAD3B cell lysate | +Inquiry |
RAB11FIP5-2137HCL | Recombinant Human RAB11FIP5 cell lysate | +Inquiry |
PLGLB2-3108HCL | Recombinant Human PLGLB2 293 Cell Lysate | +Inquiry |
CDKL1-7619HCL | Recombinant Human CDKL1 293 Cell Lysate | +Inquiry |
HYKK-387HCL | Recombinant Human HYKK lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petD Products
Required fields are marked with *
My Review for All petD Products
Required fields are marked with *
0
Inquiry Basket