Recombinant Full Length Pig Arachidonate 5-Lipoxygenase-Activating Protein(Alox5Ap) Protein, His-Tagged
Cat.No. : | RFL-3714SF |
Product Overview : | Recombinant Full Length Pig Arachidonate 5-lipoxygenase-activating protein(ALOX5AP) Protein (P30356) (1-153aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-153) |
Form : | Lyophilized powder |
AA Sequence : | MDQEAMGNIVLLAIVTLISVVQNAFFAHKVEHESKTHNGRSFQRTGTPAFERVYTANQNC VDAYPTFLVVLWSAGLFCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSLAGIFNYFLILFFGSDFENYIKTITTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALOX5AP |
Synonyms | ALOX5AP; FLAP; Arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein; Fragment |
UniProt ID | P30356 |
◆ Recombinant Proteins | ||
Sst-2619M | Recombinant Mouse Sst protein, His-tagged | +Inquiry |
NSP7-0567C | Recombinant COVID-19 NSP7 protein, His-tagged | +Inquiry |
HMGB1-118H | Recombinant Human HMGB1 Protein, Met1-Glu215, C-His tagged, Biotinylated | +Inquiry |
EXOC6B-2531H | Recombinant Human EXOC6B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TRIT1-3919Z | Recombinant Zebrafish TRIT1 | +Inquiry |
◆ Native Proteins | ||
Collagen-60H | Native Human Collagen Type II | +Inquiry |
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
PPBP-30279TH | Native Human PPBP | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-525M | Mouse Thymus Membrane Lysate | +Inquiry |
APBB3-8800HCL | Recombinant Human APBB3 293 Cell Lysate | +Inquiry |
LURAP1L-139HCL | Recombinant Human LURAP1L lysate | +Inquiry |
UBXN4-537HCL | Recombinant Human UBXN4 293 Cell Lysate | +Inquiry |
SNRPF-1612HCL | Recombinant Human SNRPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALOX5AP Products
Required fields are marked with *
My Review for All ALOX5AP Products
Required fields are marked with *
0
Inquiry Basket