Recombinant Full Length Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged
Cat.No. : | RFL13285EF |
Product Overview : | Recombinant Full Length Photosystem II reaction center protein Z(psbZ) Protein (Q4G3C6) (1-62aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emiliania huxleyi (Pontosphaera huxleyi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-62) |
Form : | Lyophilized powder |
AA Sequence : | MVGILPLFVVLLIIVSFAMVVAVPVILATPGEWEKSQGIVWSGAGLWSALVILTGVFNAV PA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbZ |
Synonyms | psbZ; Photosystem II reaction center protein Z; PSII-Z |
UniProt ID | Q4G3C6 |
◆ Native Proteins | ||
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAT1-5631HCL | Recombinant Human HAT1 293 Cell Lysate | +Inquiry |
DBT-7061HCL | Recombinant Human DBT 293 Cell Lysate | +Inquiry |
IFITM1-5283HCL | Recombinant Human IFITM1 293 Cell Lysate | +Inquiry |
HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
SK-N-SH-177H | SK-N-SH Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbZ Products
Required fields are marked with *
My Review for All psbZ Products
Required fields are marked with *
0
Inquiry Basket