Recombinant Full Length Phosphatidylcholine:Ceramide Cholinephosphotransferase 4(Sls4) Protein, His-Tagged
Cat.No. : | RFL16640TF |
Product Overview : | Recombinant Full Length Phosphatidylcholine:ceramide cholinephosphotransferase 4(SLS4) Protein (B3A0M2) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trypanosoma brucei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MISYPFFSLSPPGLVPPPMAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILA VALQITHERMPDPKVTKPLPDLGFELLTKVPGMYVLADCCIGFLNILSVFTAFKLYLLHR HCVGSGEPELPCNIPGVSRFFLSVWLCKENCRIELRNIHTIAWIRFITSYALLLLFRSAV IVMTSLPAPDDLCQDPPKIENPVKNVILTVLTAGGGSIHCGDLMYSGHTVILTLHLMFHW IYGAMVHWSFRPVVTVVAIFGYYCIVASRFHYTDDVLVAIYLTIATFIAVGHNADGAPWQ LQLFIRWWPCCGANSREVTEDSQPVMVAFKSEELDEMNGVLEGRQKKHGGVGDGESLMFK CGAYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLS4 |
Synonyms | SLS4; Phosphatidylcholine:ceramide cholinephosphotransferase 4; TbSLS4; Ethanolamine-phosphorylceramide synthase; EPC synthase; Sphingomyelin synthase; SM synthase |
UniProt ID | B3A0M2 |
◆ Recombinant Proteins | ||
RFL20079MF | Recombinant Full Length Mouse Leukocyte Surface Antigen Cd53(Cd53) Protein, His-Tagged | +Inquiry |
NADSYN1-1474H | Recombinant Human NADSYN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NEDD8-2381H | Recombinant Human NEDD8, GST-tagged | +Inquiry |
RFL18715RF | Recombinant Full Length Rhodobacter Sphaeroides Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
CKS2-26705TH | Recombinant Human CKS2, T7 -tagged | +Inquiry |
◆ Native Proteins | ||
ACP-150P | Active Native Potato Acid Phosphatase | +Inquiry |
TF-323H | Native Human Transferrin Fluorescein | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
Proteoglycans-51C | Native Chicken Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXL1-664HCL | Recombinant Human FOXL1 cell lysate | +Inquiry |
MYO1A-4010HCL | Recombinant Human MYO1A 293 Cell Lysate | +Inquiry |
DPP3-6831HCL | Recombinant Human DPP3 293 Cell Lysate | +Inquiry |
FLRT1-1958HCL | Recombinant Human FLRT1 cell lysate | +Inquiry |
LPCAT2-4671HCL | Recombinant Human LPCAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SLS4 Products
Required fields are marked with *
My Review for All SLS4 Products
Required fields are marked with *
0
Inquiry Basket