Recombinant Full Length Phaeodactylum Tricornutum Cytochrome C Biogenesis Protein Ccs1(Ccs1) Protein, His-Tagged
Cat.No. : | RFL7122PF |
Product Overview : | Recombinant Full Length Phaeodactylum tricornutum Cytochrome c biogenesis protein ccs1(ccs1) Protein (A0T0G8) (1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Phaeodactylum tricornutum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-420) |
Form : | Lyophilized powder |
AA Sequence : | MKQQIFRLLADLRFSIFLLLLISFCSIVGTVIEQDQSIEIYKTNYPLTNPVFGVLTWDRI LLFGLDHVYRTWWFFALIFLFGLSLILCTFLQQLPSLKIARRCQFFRTTNQFYRLKISTV LNDFSFNKILGRITGSQYSIFQQKNIVYCYKGLIGRIAPILVHLSMILILVGTIVGSLFG FKAQEIVPKTENFHIQNILANGQLTVIPKTSARINDFWITYTKTKTVSQFYSDISILNKQ GNEIERKTISVNHPLIHNGVYYYQTDWNLVGLRFKTMANEIIEYPLINFSENQKIWLTWI STNKSLTEGVVTIIDNLEGYCSIYNETGQFLGNIELNEIINLKQPLTLIEIISSTGLQIK TDPGIQIIYSGFFFLMLSTLISYITYSQIWIIQKEKKLFIGGTTNRAVFDFELEFFKIIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccs1 |
Synonyms | ccs1; Cytochrome c biogenesis protein Ccs1 |
UniProt ID | A0T0G8 |
◆ Native Proteins | ||
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
TF-321H | Native Human Transferrin Rhodamine | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCT6A-173HCL | Recombinant Human CCT6A lysate | +Inquiry |
CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
HES5-5581HCL | Recombinant Human HES5 293 Cell Lysate | +Inquiry |
FBP1-6316HCL | Recombinant Human FBP1 293 Cell Lysate | +Inquiry |
GFRA3-844MCL | Recombinant Mouse GFRA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccs1 Products
Required fields are marked with *
My Review for All ccs1 Products
Required fields are marked with *
0
Inquiry Basket