Recombinant Full Length Petunia Sp. Chlorophyll A-B Binding Protein 25, Chloroplastic(Cab25) Protein, His-Tagged
Cat.No. : | RFL16752PF |
Product Overview : | Recombinant Full Length Petunia sp. Chlorophyll a-b binding protein 25, chloroplastic(CAB25) Protein (P04782) (35-266aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Petunia sp. (Petunia) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (35-266) |
Form : | Lyophilized powder |
AA Sequence : | RKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CAB25 |
Synonyms | CAB25; Chlorophyll a-b binding protein 25, chloroplastic; LHCII type I CAB-25; LHCP |
UniProt ID | P04782 |
◆ Recombinant Proteins | ||
RFL31499RF | Recombinant Full Length Rat Cytochrome C Oxidase Subunit 3(Mtco3) Protein, His-Tagged | +Inquiry |
SSP-RS09035-0326S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS09035 protein, His-tagged | +Inquiry |
SAP18-31375TH | Recombinant Human SAP18, His-tagged | +Inquiry |
sucC-4565F | Recombinant Francisella tularensis subsp. novicida (strain U112) sucC protein, His&Myc-tagged | +Inquiry |
MICALL2-9830M | Recombinant Mouse MICALL2 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1734U | Active Native Ulex Europaeus Agglutinin I Protein, Rhodamine labeled | +Inquiry |
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
LDH2-8340H | Native Human LDH2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA12-3067MCL | Recombinant Mouse CA12 cell lysate | +Inquiry |
PRIM1-2870HCL | Recombinant Human PRIM1 293 Cell Lysate | +Inquiry |
FOXRED2-6140HCL | Recombinant Human FOXRED2 293 Cell Lysate | +Inquiry |
Lung-310H | Human Lung Liver Cirrhosis Lysate | +Inquiry |
ZNF521-60HCL | Recombinant Human ZNF521 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAB25 Products
Required fields are marked with *
My Review for All CAB25 Products
Required fields are marked with *
0
Inquiry Basket